Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05146
Gene name
Locationscaffold_05:2623913..2624394
Strand+
Gene length (bp)481
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00545 Ribonuclease ribonuclease 8.0E-08 46 121

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004521 endoribonuclease activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:1901363 heterocyclic compound binding No
GO:0004540 ribonuclease activity No
GO:0004518 nuclease activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003676 nucleic acid binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004519 endonuclease activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1315 0.0726 0.9603 0.0921 0.0974 0.0178 0.1134 0.1646 0.0722 0.0057

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999791

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2614
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2503
Ophiocordyceps australis map64 (Brazil) OphauB2|386
Ophiocordyceps camponoti-floridani Ophcf2|05146 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3980
Ophiocordyceps kimflemingae Ophio5|135
Ophiocordyceps subramaniannii Hirsu2|3980

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05146
MYIPYTLAVLAFVLSQAASGQDVSAQTSASCGRTSYSARDVSAASQAACQLVKDEQTAGSSNYPHRFNNFEGFHF
HDAQGPFYEFPMLSSGRVYRGGRPGPDRVIITRDCEQAGQITHTGAGGSDFVGCSGTD*
Coding >Ophcf2|05146
ATGTACATCCCCTACACTCTCGCCGTCCTGGCCTTCGTCCTGTCCCAGGCCGCGTCTGGGCAAGACGTCTCCGCC
CAGACAAGCGCCAGCTGCGGCCGAACCTCGTACTCAGCCCGGGACGTCTCAGCAGCCTCGCAAGCGGCGTGCCAG
TTGGTCAAGGACGAACAAACGGCCGGCAGTTCCAACTATCCGCACCGATTCAACAACTTTGAGGGTTTCCACTTC
CACGATGCCCAAGGGCCGTTTTACGAGTTTCCCATGCTCTCGTCCGGACGCGTCTATAGAGGAGGACGGCCGGGT
CCAGATCGAGTCATCATCACTAGAGACTGCGAGCAGGCCGGACAGATCACGCACACGGGCGCGGGAGGAAGCGAC
TTTGTCGGCTGCTCCGGCACGGATTAG
Transcript >Ophcf2|05146
ATGTACATCCCCTACACTCTCGCCGTCCTGGCCTTCGTCCTGTCCCAGGCCGCGTCTGGGCAAGACGTCTCCGCC
CAGACAAGCGCCAGCTGCGGCCGAACCTCGTACTCAGCCCGGGACGTCTCAGCAGCCTCGCAAGCGGCGTGCCAG
TTGGTCAAGGACGAACAAACGGCCGGCAGTTCCAACTATCCGCACCGATTCAACAACTTTGAGGGTTTCCACTTC
CACGATGCCCAAGGGCCGTTTTACGAGTTTCCCATGCTCTCGTCCGGACGCGTCTATAGAGGAGGACGGCCGGGT
CCAGATCGAGTCATCATCACTAGAGACTGCGAGCAGGCCGGACAGATCACGCACACGGGCGCGGGAGGAAGCGAC
TTTGTCGGCTGCTCCGGCACGGATTAG
Gene >Ophcf2|05146
ATGTACATCCCCTACACTCTCGCCGTCCTGGCCTTCGTCCTGTCCCAGGCCGCGTCTGGGCAAGACGTCTCCGCC
CAGACAAGCGCCAGCTGCGGCCGAACCTCGTACTCAGCCCGGGACGTCTCAGCAGCCTCGCAAGCGGCGTGCCAG
TTGGTCAAGGACGAACAAACGGCCGGCAGTTCCAACTATCCGCACCGATTCAACAACTTTGAGGGTTTCCACTTC
CACGATGCCCAAGGGCCGTTTTACGAGTTTCCCATGCTCTCGTCCGGACGCGTCTATAGAGGAGGTGTGTTGTTT
CCACTTGGGGAGGGGGAGGGGAGGGGGAAGAGAAGAAGACTCGAGGCTGACGTTGGGTATGATACTAGGACGGCC
GGGTCCAGATCGAGTCATCATCACTAGAGACTGCGAGCAGGCCGGACAGATCACGCACACGGGCGCGGGAGGAAG
CGACTTTGTCGGCTGCTCCGGCACGGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail