Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05137
Gene name
Locationscaffold_05:2597706..2599730
Strand+
Gene length (bp)2024
Transcript length (bp)1860
Coding sequence length (bp)1860
Protein length (aa) 620

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 3.4E-08 168 397

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0044183 protein folding chaperone No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6392 0.6173 0.2226 0.0691 0.0681 0.0043 0.0658 0.0759 0.049 0.0119

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup920
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1295
Ophiocordyceps australis 1348a (Ghana) OphauG2|1984
Ophiocordyceps australis map64 (Brazil) OphauB2|3202
Ophiocordyceps camponoti-floridani Ophcf2|05137 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5104
Ophiocordyceps kimflemingae Ophio5|6121
Ophiocordyceps subramaniannii Hirsu2|6262

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05137
MPASSLKLPLRPSHYGSSTEAINGPVREPAREQPAAGDRLIVGVDFGTTFSGVAAVYTSTPDDVEIIKTWPGGNG
ITSDKVPTEMAYDRPAPGSSEPTTRWGFQFRPDESRLRCIKLFLDRSQKLPFYVSHHDTAAQLKRYNKNVVDAVS
DYLVQIYRHSMDTLTRRYGESFMASTKVDFVLTCPAVWSDAAKNATRLAAERAGMGRRSEIQMISEPEAAAVYTL
KAIQPNNLHVGDNFVVCDAGGGTVDLIAYKIMSLKPLRVEESAVGTGGLCGSAFLNYRFEEHVRSRLGVARFEEM
KQRKGKTWQMGLRYFEEFVKRNFDEAEHHEVNVPFPGLPDDEAAGLDSGFLVMTASQIKEIFQPVVKEVCDLVQG
QVDGLRAKGGIVSGIVLVGGFGQSDFLYRQLKQHFTSAAPPPYSERPTHAGAKAGNGSSIEVMQPVYAWTAVVRG
AVLRGLEGSMVVSRKSRMHYGTSYATIFDEEKHSVNERYWSPLWERWMVSDRMQWHIAKGESLSPLAPVAFHYTR
NFRPGQSLVVTDDLIACEADEPPTAFTRGLLHVCTMTTDLNAVPRSLFTRLTTTKGVEFDNLDFTLEMIVDSAGL
GFELKVDGVRYGRVEAEFH*
Coding >Ophcf2|05137
ATGCCGGCCAGCAGCCTGAAGCTGCCGCTAAGGCCGAGCCACTATGGCAGCTCGACCGAGGCCATCAACGGGCCG
GTCCGGGAGCCGGCGCGGGAGCAACCGGCGGCCGGCGATCGTCTGATCGTGGGCGTCGACTTTGGCACCACGTTT
TCCGGCGTGGCGGCCGTTTACACTTCGACGCCTGACGATGTCGAGATCATCAAGACGTGGCCCGGGGGCAACGGC
ATCACGTCGGACAAGGTGCCGACGGAGATGGCCTACGATCGGCCCGCGCCGGGGTCTTCGGAGCCGACGACGCGA
TGGGGGTTTCAGTTCCGGCCGGACGAGTCTCGTCTTCGCTGCATCAAGCTTTTCCTCGACCGATCGCAGAAGTTG
CCCTTTTACGTGAGCCATCACGATACGGCGGCGCAGCTGAAGCGGTACAACAAGAATGTCGTCGACGCCGTTAGC
GATTACCTCGTTCAGATCTATCGCCATAGCATGGACACGCTGACGAGGCGGTACGGCGAGTCCTTCATGGCCTCG
ACAAAGGTCGACTTCGTCCTCACCTGTCCGGCCGTCTGGAGCGATGCGGCCAAGAACGCGACGCGGTTGGCGGCC
GAGAGGGCGGGCATGGGACGGAGGTCCGAGATTCAGATGATTAGCGAGCCCGAGGCGGCGGCCGTCTATACGCTC
AAGGCGATCCAGCCGAATAACCTTCACGTGGGCGACAACTTCGTCGTCTGCGACGCCGGCGGCGGCACCGTCGAC
CTCATCGCCTACAAGATCATGTCGCTGAAGCCGCTGAGGGTGGAGGAGTCGGCCGTCGGTACGGGGGGGCTGTGC
GGCTCGGCTTTTCTCAACTATCGGTTCGAGGAGCACGTTAGGAGCAGGCTTGGCGTGGCGCGCTTTGAGGAGATG
AAGCAGCGCAAGGGCAAGACGTGGCAGATGGGATTGCGATATTTTGAGGAGTTTGTCAAGAGGAACTTTGATGAG
GCAGAGCATCACGAGGTCAACGTGCCCTTCCCAGGTCTGCCGGACGACGAGGCCGCGGGCCTAGACTCGGGATTC
CTCGTCATGACGGCCTCGCAGATCAAGGAAATCTTTCAGCCCGTCGTCAAGGAAGTCTGCGACCTCGTACAGGGC
CAGGTCGACGGTCTGCGGGCCAAGGGCGGCATCGTCTCCGGCATCGTCCTCGTCGGCGGCTTCGGCCAGAGCGAC
TTTCTCTACCGGCAGCTGAAGCAGCACTTTACCAGCGCGGCGCCGCCTCCCTACAGCGAGAGGCCGACTCACGCG
GGTGCCAAGGCGGGGAACGGATCTTCGATTGAGGTGATGCAGCCCGTCTACGCCTGGACGGCCGTGGTTCGCGGT
GCGGTCCTCAGGGGGCTCGAGGGAAGCATGGTGGTTTCGAGGAAGTCGAGGATGCATTACGGGACGTCGTATGCC
ACCATCTTTGACGAGGAGAAGCACTCGGTGAACGAGCGGTATTGGTCTCCGCTGTGGGAGAGGTGGATGGTCTCG
GATCGGATGCAGTGGCATATAGCCAAGGGTGAGTCCCTCTCCCCTCTGGCGCCCGTAGCCTTTCACTACACGCGC
AACTTCCGACCGGGCCAGTCGCTGGTGGTGACGGACGACCTCATTGCGTGCGAAGCGGACGAGCCGCCGACGGCC
TTCACGCGGGGGCTCCTTCACGTGTGCACCATGACGACGGACCTGAATGCGGTGCCGAGGAGTTTGTTTACGAGG
CTGACGACGACGAAGGGTGTCGAGTTTGATAACTTGGATTTCACGCTCGAGATGATTGTTGATAGTGCTGGGTTG
GGTTTTGAGCTCAAGGTTGATGGGGTTAGGTATGGGAGGGTTGAGGCTGAGTTTCATTGA
Transcript >Ophcf2|05137
ATGCCGGCCAGCAGCCTGAAGCTGCCGCTAAGGCCGAGCCACTATGGCAGCTCGACCGAGGCCATCAACGGGCCG
GTCCGGGAGCCGGCGCGGGAGCAACCGGCGGCCGGCGATCGTCTGATCGTGGGCGTCGACTTTGGCACCACGTTT
TCCGGCGTGGCGGCCGTTTACACTTCGACGCCTGACGATGTCGAGATCATCAAGACGTGGCCCGGGGGCAACGGC
ATCACGTCGGACAAGGTGCCGACGGAGATGGCCTACGATCGGCCCGCGCCGGGGTCTTCGGAGCCGACGACGCGA
TGGGGGTTTCAGTTCCGGCCGGACGAGTCTCGTCTTCGCTGCATCAAGCTTTTCCTCGACCGATCGCAGAAGTTG
CCCTTTTACGTGAGCCATCACGATACGGCGGCGCAGCTGAAGCGGTACAACAAGAATGTCGTCGACGCCGTTAGC
GATTACCTCGTTCAGATCTATCGCCATAGCATGGACACGCTGACGAGGCGGTACGGCGAGTCCTTCATGGCCTCG
ACAAAGGTCGACTTCGTCCTCACCTGTCCGGCCGTCTGGAGCGATGCGGCCAAGAACGCGACGCGGTTGGCGGCC
GAGAGGGCGGGCATGGGACGGAGGTCCGAGATTCAGATGATTAGCGAGCCCGAGGCGGCGGCCGTCTATACGCTC
AAGGCGATCCAGCCGAATAACCTTCACGTGGGCGACAACTTCGTCGTCTGCGACGCCGGCGGCGGCACCGTCGAC
CTCATCGCCTACAAGATCATGTCGCTGAAGCCGCTGAGGGTGGAGGAGTCGGCCGTCGGTACGGGGGGGCTGTGC
GGCTCGGCTTTTCTCAACTATCGGTTCGAGGAGCACGTTAGGAGCAGGCTTGGCGTGGCGCGCTTTGAGGAGATG
AAGCAGCGCAAGGGCAAGACGTGGCAGATGGGATTGCGATATTTTGAGGAGTTTGTCAAGAGGAACTTTGATGAG
GCAGAGCATCACGAGGTCAACGTGCCCTTCCCAGGTCTGCCGGACGACGAGGCCGCGGGCCTAGACTCGGGATTC
CTCGTCATGACGGCCTCGCAGATCAAGGAAATCTTTCAGCCCGTCGTCAAGGAAGTCTGCGACCTCGTACAGGGC
CAGGTCGACGGTCTGCGGGCCAAGGGCGGCATCGTCTCCGGCATCGTCCTCGTCGGCGGCTTCGGCCAGAGCGAC
TTTCTCTACCGGCAGCTGAAGCAGCACTTTACCAGCGCGGCGCCGCCTCCCTACAGCGAGAGGCCGACTCACGCG
GGTGCCAAGGCGGGGAACGGATCTTCGATTGAGGTGATGCAGCCCGTCTACGCCTGGACGGCCGTGGTTCGCGGT
GCGGTCCTCAGGGGGCTCGAGGGAAGCATGGTGGTTTCGAGGAAGTCGAGGATGCATTACGGGACGTCGTATGCC
ACCATCTTTGACGAGGAGAAGCACTCGGTGAACGAGCGGTATTGGTCTCCGCTGTGGGAGAGGTGGATGGTCTCG
GATCGGATGCAGTGGCATATAGCCAAGGGTGAGTCCCTCTCCCCTCTGGCGCCCGTAGCCTTTCACTACACGCGC
AACTTCCGACCGGGCCAGTCGCTGGTGGTGACGGACGACCTCATTGCGTGCGAAGCGGACGAGCCGCCGACGGCC
TTCACGCGGGGGCTCCTTCACGTGTGCACCATGACGACGGACCTGAATGCGGTGCCGAGGAGTTTGTTTACGAGG
CTGACGACGACGAAGGGTGTCGAGTTTGATAACTTGGATTTCACGCTCGAGATGATTGTTGATAGTGCTGGGTTG
GGTTTTGAGCTCAAGGTTGATGGGGTTAGGTATGGGAGGGTTGAGGCTGAGTTTCATTGA
Gene >Ophcf2|05137
ATGCCGGCCAGCAGCCTGAAGCTGCCGCTAAGGCCGAGCCACTATGGCAGCTCGACCGAGGCCATCAACGGGCCG
GTCCGGGAGCCGGCGCGGGAGCAACCGGCGGCCGGCGATCGTCTGATCGTGGGCGTCGACTTTGGCACCACGTTT
TCCGGCGTGGCGGCCGTTTACACTTCGACGCCTGACGATGTCGAGATCATCAAGACGTGGCCCGGGGGCAACGGC
ATCACGTCGGACAAGGTGCCGACGGAGATGGCCTACGATCGGCCCGCGCCGGGGTCTTCGGAGCCGACGACGCGA
TGGGGGTTTCAGTTCCGGCCGGACGAGTCTCGTCTTCGCTGCATCAAGCTTTTCCTCGACCGATCGCAGAAGTTG
CCCTTTTACGTGAGCCATCACGATACGGCGGCGCAGCTGAAGCGGTACAACAAGAATGTCGTCGACGCCGTTAGC
GATTACCTCGTTCAGATCTATCGCCATAGCATGGACACGCTGACGAGGCGGTACGGCGAGTCCTTCATGGCCTCG
ACAAAGGTCGACTTCGTCCTCACCTGTCCGGCCGTCTGGAGCGATGCGGCCAAGAACGCGACGCGGTTGGCGGCC
GAGAGGGCGGGCATGGGACGGAGGTCCGAGATTCAGATGATTAGCGAGCCCGAGGCGGCGGCCGTCTATACGCTC
AAGGCGATCCAGCCGAATAACCTTCACGTGGGCGACAACTTCGTCGTCTGCGACGCCGGCGGCGGCACCGTCGAC
CTCATCGCCTACAAGATCATGTCGCTGAAGCCGCTGAGGGTGGAGGAGTCGGCCGTCGGTACGGGGGGGCTGTGC
GGCTCGGCTTTTCTCAACTATCGGTTCGAGGAGCACGTTAGGAGCAGGCTTGGCGTGGCGCGCTTTGAGGAGATG
AAGCAGCGCAAGGGCAAGACGTGGCAGATGGGATTGCGATATTTTGAGGAGTTTGTCAAGAGGAACTTTGATGAG
GCAGAGCATCACGAGGTCAACGTGCCGTACGGTTTCACCCGTCTTCTTCTTCTTCCTTTTTTTTTTTTTTTTTTT
TTTTTGTGTTTGTTGACTGAATCTGATGTTCGAACGAGTAGCTTCCCAGGTCTGCCGGACGACGAGGCCGCGGGC
CTAGACTCGGGATTCCTCGTCATGACGGCCTCGCAGATCAAGGAAATCTTTCAGCCCGTCGTCAAGGAAGTCTGC
GACCTCGTACAGGGCCAGGTCGACGGTCTGCGGGCCAAGGGCGGCATCGTCTCCGGCATCGTCCTCGTCGGCGGC
TTCGGCCAGAGCGACTTTCTCTACCGGCAGCTGAAGCAGCACTTTACCAGCGCGGCGCCGCCTCCCTACAGCGAG
AGGCCGACTCACGCGGGTGCCAAGGCGGGGAACGGATCTTCGATTGAGGTGATGCAGCCCGTCTACGCCTGGACG
GCCGTGGTTCGCGGTGCGGTCCTCAGGGGGCTCGAGGGAAGCATGGTGGTTTCGAGGAAGTCGAGGATGCATTAC
GGGACGTCGTATGCCACCATCTTTGACGAGGAGAAGCACTCGGTGAACGAGCGGTATTGGTCTCCGCTGTGGGAG
AGGTGGATGGTCTCGGATCGGATGCAGTGGCATATAGCCAAGGCGAGTCACCCCCAATCCCTTGTCTCTCTTTTG
GTTTTATAGGCACTGACCGACTTACCAAACCGATTTCCCAGGGTGAGTCCCTCTCCCCTCTGGCGCCCGTAGCCT
TTCACTACACGCGCAACTTCCGACCGGGCCAGTCGCTGGTGGTGACGGACGACCTCATTGCGTGCGAAGCGGACG
AGCCGCCGACGGCCTTCACGCGGGGGCTCCTTCACGTGTGCACCATGACGACGGACCTGAATGCGGTGCCGAGGA
GTTTGTTTACGAGGCTGACGACGACGAAGGGTGTCGAGTTTGATAACTTGGATTTCACGCTCGAGATGATTGTTG
ATAGTGCTGGGTTGGGTTTTGAGCTCAAGGTTGATGGGGTTAGGTATGGGAGGGTTGAGGCTGAGTTTCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail