Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05135
Gene name
Locationscaffold_05:2587480..2588959
Strand+
Gene length (bp)1479
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12898 Stc1 Stc1 domain 4.3E-20 23 106

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6865 0.7007 0.0193 0.0514 0.0949 0.0084 0.1269 0.0732 0.1032 0.0101

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2124
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4689
Ophiocordyceps australis map64 (Brazil) OphauB2|3196
Ophiocordyceps camponoti-floridani Ophcf2|05135 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5923
Ophiocordyceps kimflemingae Ophio5|6118
Ophiocordyceps subramaniannii Hirsu2|2532

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05135
MPRSRKTPLDLGTGQPAAPTRFRCKVGGEWLPLTSFSNAQQKLVQRQIGRHGSGPVNPANSGMTCRDHSAASRTE
LRCELCTLIKPITEFSRNSRQSDENICKRCSAWDETQEPNVTPAPLETGHVSIEEMNREVWQQNYVESNDFFDEL
PRAPITELASLGLEDDTTVKARLSGIRSQNAGLTESEAMAKLVSDAMPNSGPNSGSSLYGGRSSESGSVHSMPPH
LRGRYQSGSDLETATTDSLPVSSSSSQAGTGSVSGSALPPHLRKLASKGNSDQAAKIPFNAWGPDGNLRQGLKSV
TANSSNNSQFFTDTSHTKPSSTSCSAANSTSGSDNGYKGKDKKPTRKGGFAKPPRLSRADMHQFDGCTPIGVAHI
DPSIEQMRKMQYCQSEDSDY*
Coding >Ophcf2|05135
ATGCCGCGATCCAGGAAAACTCCTCTGGATCTTGGGACTGGACAGCCTGCGGCTCCCACGAGGTTCCGATGCAAA
GTCGGCGGCGAGTGGCTGCCCTTGACCTCCTTCTCAAACGCCCAGCAGAAGCTCGTTCAGCGGCAGATTGGCCGT
CATGGCTCCGGCCCTGTCAACCCGGCGAACTCTGGCATGACGTGCCGTGATCATTCGGCTGCCAGTCGGACCGAG
TTGCGCTGCGAACTTTGCACCCTGATCAAACCCATCACCGAATTCAGCCGAAACAGCAGGCAAAGTGACGAAAAT
ATCTGCAAACGATGCTCCGCCTGGGATGAGACGCAAGAGCCCAACGTAACTCCGGCTCCTCTGGAGACGGGCCAC
GTCTCCATCGAGGAGATGAACCGCGAGGTGTGGCAGCAAAATTATGTCGAGAGCAACGACTTTTTCGATGAACTA
CCTCGCGCGCCCATCACGGAGTTGGCCTCCTTGGGACTCGAGGACGACACAACGGTCAAGGCACGCCTGTCCGGT
ATTCGAAGCCAGAACGCCGGATTGACCGAGTCGGAAGCCATGGCCAAACTCGTCTCCGATGCCATGCCCAACAGC
GGTCCCAACAGCGGCTCTTCTTTGTATGGCGGTCGTTCTAGCGAATCTGGCTCGGTTCATTCGATGCCTCCCCAC
CTCAGGGGCCGATATCAGAGCGGCTCGGATCTCGAGACGGCCACGACCGACTCTCTCCCCGTTAGCAGCAGCAGC
AGCCAGGCCGGCACCGGCTCCGTATCCGGCTCGGCTCTTCCGCCTCACCTTCGAAAGCTGGCCAGCAAAGGCAAC
TCAGACCAGGCCGCCAAGATTCCCTTCAACGCCTGGGGTCCCGACGGCAACCTACGCCAGGGCCTCAAGTCCGTG
ACGGCCAACTCGTCGAACAACTCTCAATTTTTCACCGACACGAGCCACACGAAGCCGTCCAGTACCAGCTGCAGT
GCCGCCAATAGTACCAGCGGCAGTGACAACGGTTATAAGGGCAAAGACAAAAAACCCACCAGAAAGGGGGGTTTT
GCCAAGCCCCCGCGACTGTCCCGGGCCGATATGCATCAGTTCGATGGTTGCACTCCCATCGGGGTTGCGCACATT
GATCCGTCCATCGAGCAGATGCGTAAGATGCAGTACTGCCAGTCCGAAGACTCGGACTACTAA
Transcript >Ophcf2|05135
ATGCCGCGATCCAGGAAAACTCCTCTGGATCTTGGGACTGGACAGCCTGCGGCTCCCACGAGGTTCCGATGCAAA
GTCGGCGGCGAGTGGCTGCCCTTGACCTCCTTCTCAAACGCCCAGCAGAAGCTCGTTCAGCGGCAGATTGGCCGT
CATGGCTCCGGCCCTGTCAACCCGGCGAACTCTGGCATGACGTGCCGTGATCATTCGGCTGCCAGTCGGACCGAG
TTGCGCTGCGAACTTTGCACCCTGATCAAACCCATCACCGAATTCAGCCGAAACAGCAGGCAAAGTGACGAAAAT
ATCTGCAAACGATGCTCCGCCTGGGATGAGACGCAAGAGCCCAACGTAACTCCGGCTCCTCTGGAGACGGGCCAC
GTCTCCATCGAGGAGATGAACCGCGAGGTGTGGCAGCAAAATTATGTCGAGAGCAACGACTTTTTCGATGAACTA
CCTCGCGCGCCCATCACGGAGTTGGCCTCCTTGGGACTCGAGGACGACACAACGGTCAAGGCACGCCTGTCCGGT
ATTCGAAGCCAGAACGCCGGATTGACCGAGTCGGAAGCCATGGCCAAACTCGTCTCCGATGCCATGCCCAACAGC
GGTCCCAACAGCGGCTCTTCTTTGTATGGCGGTCGTTCTAGCGAATCTGGCTCGGTTCATTCGATGCCTCCCCAC
CTCAGGGGCCGATATCAGAGCGGCTCGGATCTCGAGACGGCCACGACCGACTCTCTCCCCGTTAGCAGCAGCAGC
AGCCAGGCCGGCACCGGCTCCGTATCCGGCTCGGCTCTTCCGCCTCACCTTCGAAAGCTGGCCAGCAAAGGCAAC
TCAGACCAGGCCGCCAAGATTCCCTTCAACGCCTGGGGTCCCGACGGCAACCTACGCCAGGGCCTCAAGTCCGTG
ACGGCCAACTCGTCGAACAACTCTCAATTTTTCACCGACACGAGCCACACGAAGCCGTCCAGTACCAGCTGCAGT
GCCGCCAATAGTACCAGCGGCAGTGACAACGGTTATAAGGGCAAAGACAAAAAACCCACCAGAAAGGGGGGTTTT
GCCAAGCCCCCGCGACTGTCCCGGGCCGATATGCATCAGTTCGATGGTTGCACTCCCATCGGGGTTGCGCACATT
GATCCGTCCATCGAGCAGATGCGTAAGATGCAGTACTGCCAGTCCGAAGACTCGGACTACTAA
Gene >Ophcf2|05135
ATGCCGCGATCCAGGAAAACTCCTCTGGATCTGTGAGAAGTCTTTCTCTCGTCGACTGGCAAAGACAACGGCTGA
TACATGCTTTCGCAGTGGGACTGGACAGCCTGCGGCTCCCACGAGGTATGACGCGACGGCTGTTATCTCGTGCAG
CTTTTCACCTTCTTTCCCTCGCATACTTCCCTAACCCTACTCCCGCTTTTGCTCGTGACTGAAACTGCATGACAG
GTTCCGATGCAAAGTCGGCGGCGAGTGGCTGCCCTTGACCTCCTTCTCAAACGCCCAGCAGAAGCTCGTTCAGCG
GCAGATTGGCCGTCATGGCTCCGGCCCTGTCAACCCGGCGAACTCTGGCATGACGTGCCGTGATCATTCGGCTGC
CAGTCGGACCGAGTTGCGCTGCGAACTTTGCACCCTGATCAAACCCATCACCGAATTCAGCCGAAACAGCAGGCA
AAGTGACGAAAATGTATTTTTTTATTTTTATTTTTTTGCCCGCGTTACCTATCTCCAGATATTCGCTAAGATGCT
CTCCGACAGATCTGCAAACGATGCTCCGCCTGGGATGAGACGCAAGAGCCCAACGTAACTCCGGCTCCTCTGGAG
ACGGGCCACGTCTCCATCGAGGAGATGAACCGCGAGGTGTGGCAGCAAAATTATGTCGAGAGCAACGACTTTTTC
GATGAACTACCTCGCGTGGGTGTCACGTCTCTTCTTTGTCCCTTGCCAGTCAGTGTAGCTAATCATTTTCAGGCG
CCCATCACGGAGTTGGCCTCCTTGGGACTCGAGGACGACACAACGGTCAAGGCACGCCTGTCCGGTATTCGAAGC
CAGAACGCCGGATTGACCGAGTCGGAAGCCATGGCCAAACTCGTCTCCGATGCCATGCCCAACAGCGGTCCCAAC
AGCGGCTCTTCTTTGTATGGCGGTCGTTCTAGCGAATCTGGCTCGGTTCATTCGATGCCTCCCCACCTCAGGGGC
CGATATCAGAGCGGCTCGGATCTCGAGACGGCCACGACCGACTCTCTCCCCGTTAGCAGCAGCAGCAGCCAGGCC
GGCACCGGCTCCGTATCCGGCTCGGCTCTTCCGCCTCACCTTCGAAAGCTGGCCAGCAAAGGCAACTCAGACCAG
GCCGCCAAGATTCCCTTCAACGCCTGGGGTCCCGACGGCAACCTACGCCAGGGCCTCAAGTCCGTGACGGCCAAC
TCGTCGAACAACTCTCAATTTTTCACCGACACGAGCCACACGAAGCCGTCCAGTACCAGCTGCAGTGCCGCCAAT
AGTACCAGCGGCAGTGACAACGGTTATAAGGGCAAAGACAAAAAACCCACCAGAAAGGGGGGTTTTGCCAAGCCC
CCGCGACTGTCCCGGGCCGATATGCATCAGTTCGATGGTTGCACTCCCATCGGGGTTGCGCACATTGATCCGTCC
ATCGAGCAGATGCGTAAGATGCAGTACTGCCAGTCCGAAGACTCGGACTACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail