Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05130
Gene name
Locationscaffold_05:2574260..2575386
Strand+
Gene length (bp)1126
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family 3.7E-68 74 299

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1485 0.1224 0.1467 0.0975 0.0707 0.0169 0.4537 0.2779 0.8603 0.0154

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 40 59 19

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT34 1.2E-72 75 300

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2656
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4694
Ophiocordyceps australis map64 (Brazil) OphauB2|6296
Ophiocordyceps camponoti-floridani Ophcf2|05130 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4647
Ophiocordyceps kimflemingae Ophio5|2955
Ophiocordyceps subramaniannii Hirsu2|4094

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05130
MSPRLGDGIMHFAYPPRKSSNPPRFRPRSARLPVLRRSRLKLLVLGFVTLVTLAYLVIGRRKADVLLKRIPSGSP
PVVLVTVIDPTTWDNGYLRTVKENREKYAERHGYEAMVVKAFDYDTSGAPQSWAKIVAMRHALSKYPDCRFVWYL
DQNAYIMDPAKSLEELVLEPKTLERLMIKDYPVVPPDSIIKTFSHLKGQDADFIVSQDKDSLVHASVIVRNGEWA
RYFIETWFDPLYRSYNFQKAERHALEHLVQWHPTILSKLALVPQRTIAAYPNAKSGAAYQKGDMVIIFPDCKPQT
CEPESKPYLDQWRSALQQDLT*
Coding >Ophcf2|05130
ATGTCGCCTCGCCTCGGCGACGGCATCATGCACTTCGCCTATCCGCCTCGCAAGAGCTCCAACCCGCCGCGCTTT
CGGCCCCGATCGGCGAGGCTGCCCGTCCTGCGACGGAGCCGGTTAAAACTGCTGGTTTTGGGCTTCGTCACCCTC
GTCACCCTCGCCTACCTCGTCATCGGCCGTCGAAAAGCAGACGTCCTGCTCAAGCGCATTCCGTCGGGATCGCCT
CCTGTCGTGCTGGTGACCGTCATCGATCCGACGACGTGGGATAATGGCTACCTGCGAACCGTCAAGGAGAATCGC
GAAAAGTACGCCGAGAGACATGGTTACGAGGCCATGGTGGTCAAGGCTTTCGACTATGACACGAGCGGCGCGCCA
CAGTCATGGGCCAAGATTGTGGCAATGCGCCACGCGCTGTCGAAATATCCGGACTGCCGATTCGTCTGGTATCTA
GATCAGAACGCCTACATCATGGATCCGGCCAAGAGCCTCGAGGAGCTGGTGCTCGAGCCTAAGACGCTGGAGCGG
CTGATGATCAAGGACTACCCCGTCGTGCCGCCTGACAGCATCATCAAGACGTTTTCGCACCTCAAGGGTCAGGAC
GCCGACTTCATCGTGAGCCAGGACAAGGATAGCCTGGTGCACGCGAGCGTCATCGTGCGCAACGGCGAATGGGCA
AGGTACTTTATCGAGACGTGGTTCGACCCTCTCTACCGGAGCTACAACTTTCAGAAGGCCGAGCGGCATGCACTG
GAGCACTTGGTCCAGTGGCATCCTACGATCCTCTCCAAGCTAGCCCTCGTCCCGCAGCGCACCATTGCCGCCTAT
CCCAACGCCAAGTCAGGCGCCGCCTACCAAAAGGGCGACATGGTCATCATATTCCCAGACTGCAAGCCGCAGACA
TGCGAGCCGGAATCGAAGCCGTATCTCGACCAATGGCGGAGCGCGCTACAGCAAGACTTGACTTGA
Transcript >Ophcf2|05130
ATGTCGCCTCGCCTCGGCGACGGCATCATGCACTTCGCCTATCCGCCTCGCAAGAGCTCCAACCCGCCGCGCTTT
CGGCCCCGATCGGCGAGGCTGCCCGTCCTGCGACGGAGCCGGTTAAAACTGCTGGTTTTGGGCTTCGTCACCCTC
GTCACCCTCGCCTACCTCGTCATCGGCCGTCGAAAAGCAGACGTCCTGCTCAAGCGCATTCCGTCGGGATCGCCT
CCTGTCGTGCTGGTGACCGTCATCGATCCGACGACGTGGGATAATGGCTACCTGCGAACCGTCAAGGAGAATCGC
GAAAAGTACGCCGAGAGACATGGTTACGAGGCCATGGTGGTCAAGGCTTTCGACTATGACACGAGCGGCGCGCCA
CAGTCATGGGCCAAGATTGTGGCAATGCGCCACGCGCTGTCGAAATATCCGGACTGCCGATTCGTCTGGTATCTA
GATCAGAACGCCTACATCATGGATCCGGCCAAGAGCCTCGAGGAGCTGGTGCTCGAGCCTAAGACGCTGGAGCGG
CTGATGATCAAGGACTACCCCGTCGTGCCGCCTGACAGCATCATCAAGACGTTTTCGCACCTCAAGGGTCAGGAC
GCCGACTTCATCGTGAGCCAGGACAAGGATAGCCTGGTGCACGCGAGCGTCATCGTGCGCAACGGCGAATGGGCA
AGGTACTTTATCGAGACGTGGTTCGACCCTCTCTACCGGAGCTACAACTTTCAGAAGGCCGAGCGGCATGCACTG
GAGCACTTGGTCCAGTGGCATCCTACGATCCTCTCCAAGCTAGCCCTCGTCCCGCAGCGCACCATTGCCGCCTAT
CCCAACGCCAAGTCAGGCGCCGCCTACCAAAAGGGCGACATGGTCATCATATTCCCAGACTGCAAGCCGCAGACA
TGCGAGCCGGAATCGAAGCCGTATCTCGACCAATGGCGGAGCGCGCTACAGCAAGACTTGACTTGA
Gene >Ophcf2|05130
ATGTCGCCTCGCCTCGGCGACGGCATCATGCACTTCGCCTATCCGCCTCGCAAGAGCTCCAACCCGCCGCGCTTT
CGGCCCCGATCGGCGAGGCTGCCCGTCCTGCGACGGAGCCGGTTAAAACTGCTGGTTTTGGGCTTCGTCACCCTC
GTCACCCTCGCCTACCTCGTCATCGGCCGTCGAAAAGCAGACGTCCTGCTCAAGCGCATTCCGTCGGGATCGCCT
CCTGTCGTGCTGGTGACCGTCATCGATCCGACGACGTGGGATAATGGCTACCTGCGAACCGTCAAGGAGAATCGC
GAAAAGTACGCCGAGAGACATGGTCAGGCTTCCTCCATCCCTTCCCCCCCCCCTATCCTCAACGTCCATGCCGCT
GACCTCTGAATTTTTTTCTTTTCTGGGTCCAGGTTACGAGGCCATGGTGGTCAAGGCTTTCGACTATGACACGAG
CGGCGCGCCACAGTCATGGGCCAAGATTGTGGCAATGCGCCACGCGCTGTCGAAATATCCGGACTGCCGATTCGT
CTGGTATCTAGATCAGAACGCCTACATCATGGATCCGGCCAAGAGCCTCGAGGAGCTGGTGCTCGAGCCTAAGAC
GCTGGAGCGGCTGATGATCAAGGACTACCCCGTCGTGCCGCCTGACAGCATCATCAAGACGTTTTCGCACCTCAA
GGGTCAGGACGCCGACTTCATCGTGAGCCAGGACAAGGATAGCCTGGTGCACGCGAGCGTCATCGTGCGCAACGG
CGAATGGGCAAGGTACTTTATCGAGACGTGGTTCGACCCTCTCTACCGGAGCTACAACTTTCAGAAGGCCGAGCG
GCATGCACTGGTTCGTCTCTTATTCCGGTGGTGTTGGTGTTTGTGGTGTTGGCATGATTAGGAACTAACCAAGTC
ATGGGCACAGGAGCACTTGGTCCAGTGGCATCCTACGATCCTCTCCAAGCTAGCCCTCGTCCCGCAGCGCACCAT
TGCCGCCTATCCCAACGCCAAGTCAGGCGCCGCCTACCAAAAGGGCGACATGGTCATCATATTCCCAGACTGCAA
GCCGCAGACATGCGAGCCGGAATCGAAGCCGTATCTCGACCAATGGCGGAGCGCGCTACAGCAAGACTTGACTTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail