Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05129
Gene name
Locationscaffold_05:2571287..2572268
Strand+
Gene length (bp)981
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12906 RINGv RING-variant domain 2.1E-08 92 134

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 156 178 22
2 222 244 22
3 265 287 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05129
MNAQPTWDWDSLSGHPADEPAHQDTCRQPPEDESVEEPKTSQTNTRQRTRYGPRTCRICLDSEEPKFPTEATSTL
GISSASSRPSYVSDDAELGRLLSPCKCKGSQKYVHEGCLNSWRLANPMADRNYWQCPTCKFNYRLARLHWASMLS
SKWSQVALTLVVVVVGLFILGFVADPILDLWFDPVGTISDTVTSVVSDVEAMKPRVSETSDSWTEHFLKGFFSLG
FVGFLKSLVAMGPWQWMNLRTSGLLGSGRRRGGTGRARMDNFNLVFVLIGAFTFLMAIWRGVRTVSARVLNKVSD
KVLDVGGDDADEDVDDGTEAETKKDQ*
Coding >Ophcf2|05129
ATGAACGCTCAACCGACGTGGGACTGGGACTCTCTGTCCGGCCACCCAGCGGACGAGCCGGCCCATCAAGACACC
TGCAGACAACCGCCGGAAGACGAGTCGGTCGAGGAGCCAAAAACTTCGCAGACGAATACGAGACAGCGCACTCGC
TATGGGCCCAGGACGTGTCGTATATGTTTGGACTCGGAGGAGCCCAAGTTCCCGACCGAGGCGACGTCGACTCTG
GGCATCTCGTCGGCCTCATCTCGTCCCTCGTACGTGTCTGACGATGCCGAACTGGGCAGATTGCTATCACCATGC
AAATGCAAGGGATCGCAGAAGTACGTGCACGAAGGGTGCCTCAACTCATGGCGGTTGGCGAATCCGATGGCCGAT
AGGAATTACTGGCAATGTCCAACCTGCAAATTCAACTACCGACTAGCGCGGCTGCACTGGGCCTCGATGCTGAGC
AGCAAGTGGTCACAGGTGGCGCTGACACTCGTCGTCGTCGTCGTTGGGCTCTTTATTCTGGGCTTCGTCGCAGAT
CCCATACTGGACCTGTGGTTCGACCCAGTTGGCACCATCAGTGACACCGTGACCAGCGTCGTTTCCGATGTCGAG
GCCATGAAGCCCCGGGTCTCCGAGACGTCTGACTCGTGGACGGAGCATTTCCTCAAGGGTTTCTTCTCGCTCGGC
TTCGTCGGCTTCCTCAAGTCGCTGGTCGCCATGGGCCCCTGGCAGTGGATGAACCTCCGGACCAGCGGACTGCTG
GGCTCCGGTCGTCGACGCGGCGGAACCGGAAGGGCAAGGATGGATAACTTTAATCTCGTCTTTGTTCTCATCGGT
GCCTTTACCTTTCTCATGGCCATCTGGAGAGGCGTCCGGACGGTCAGCGCACGCGTACTCAACAAAGTGAGCGAC
AAGGTGCTCGACGTCGGCGGAGACGACGCCGACGAGGACGTCGACGACGGAACTGAAGCGGAGACTAAAAAGGAT
CAATAA
Transcript >Ophcf2|05129
ATGAACGCTCAACCGACGTGGGACTGGGACTCTCTGTCCGGCCACCCAGCGGACGAGCCGGCCCATCAAGACACC
TGCAGACAACCGCCGGAAGACGAGTCGGTCGAGGAGCCAAAAACTTCGCAGACGAATACGAGACAGCGCACTCGC
TATGGGCCCAGGACGTGTCGTATATGTTTGGACTCGGAGGAGCCCAAGTTCCCGACCGAGGCGACGTCGACTCTG
GGCATCTCGTCGGCCTCATCTCGTCCCTCGTACGTGTCTGACGATGCCGAACTGGGCAGATTGCTATCACCATGC
AAATGCAAGGGATCGCAGAAGTACGTGCACGAAGGGTGCCTCAACTCATGGCGGTTGGCGAATCCGATGGCCGAT
AGGAATTACTGGCAATGTCCAACCTGCAAATTCAACTACCGACTAGCGCGGCTGCACTGGGCCTCGATGCTGAGC
AGCAAGTGGTCACAGGTGGCGCTGACACTCGTCGTCGTCGTCGTTGGGCTCTTTATTCTGGGCTTCGTCGCAGAT
CCCATACTGGACCTGTGGTTCGACCCAGTTGGCACCATCAGTGACACCGTGACCAGCGTCGTTTCCGATGTCGAG
GCCATGAAGCCCCGGGTCTCCGAGACGTCTGACTCGTGGACGGAGCATTTCCTCAAGGGTTTCTTCTCGCTCGGC
TTCGTCGGCTTCCTCAAGTCGCTGGTCGCCATGGGCCCCTGGCAGTGGATGAACCTCCGGACCAGCGGACTGCTG
GGCTCCGGTCGTCGACGCGGCGGAACCGGAAGGGCAAGGATGGATAACTTTAATCTCGTCTTTGTTCTCATCGGT
GCCTTTACCTTTCTCATGGCCATCTGGAGAGGCGTCCGGACGGTCAGCGCACGCGTACTCAACAAAGTGAGCGAC
AAGGTGCTCGACGTCGGCGGAGACGACGCCGACGAGGACGTCGACGACGGAACTGAAGCGGAGACTAAAAAGGAT
CAATAA
Gene >Ophcf2|05129
ATGAACGCTCAACCGACGTGGGACTGGGACTCTCTGTCCGGCCACCCAGCGGACGAGCCGGCCCATCAAGACACC
TGCAGACAACCGCCGGAAGACGAGTCGGTCGAGGAGCCAAAAACTTCGCAGACGAATACGAGACAGCGCACTCGC
TATGGGCCCAGGACGTGTCGTATATGTTTGGACTCGGAGGAGCCCAAGTTCCCGACCGAGGCGACGTCGACTCTG
GGCATCTCGTCGGCCTCATCTCGTCCCTCGTACGTGTCTGACGATGCCGAACTGGGCAGATTGCTATCACCATGC
AAATGCAAGGGATCGCAGAAGTACGTGCACGAAGGGTGCCTCAACTCATGGCGGTTGGCGAATCCGATGGCCGAT
AGGAATTACTGGCAATGTCCAACCTGCAAATTCAACTACCGACTAGCGCGGCTGCACTGGGCCTCGATGCTGAGC
AGCAAGTGGTCACAGGTGGCGCTGACACTCGTCGTCGTCGTCGTTGGGCTCTTTATTCTGGGCTTCGTCGCAGAT
CCCATACTGGACCTGTGGTTCGACCCAGTTGGCACCATCAGTGACACCGTGACCAGCGTCGTTTCCGATGTCGAG
GCCATGAAGCCCCGGGTCTCCGAGACGTCTGACTCGTGGACGGAGCATTTCCTCAAGGGTTTCTTCTCGCTCGGC
TTCGTCGGCTTCCTCAAGTCGCTGGTCGCCATGGGCCCCTGGCAGTGGATGAACCTCCGGACCAGCGGACTGCTG
GGCTCCGGTCGTCGACGCGGCGGAACCGGAAGGGCAAGGATGGATAACTTTAATCTCGTCTTTGTTCTCATCGGT
GCCTTTACCTTTCTCATGGCCATCTGGAGAGGCGTCCGGACGGTCAGCGCACGCGTACTCAACAAAGTGAGCGAC
AAGGTGCTCGACGTCGGCGGAGACGACGCCGACGAGGACGTCGACGACGGAACTGAAGCGGAGACTAAAAAGGAT
CAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail