Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05124
Gene name
Locationscaffold_05:2561882..2562598
Strand-
Gene length (bp)716
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01981 PTH2 Peptidyl-tRNA hydrolase PTH2 2.7E-45 94 213

GO

GO Term Description Terminal node
GO:0004045 aminoacyl-tRNA hydrolase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0052689 carboxylic ester hydrolase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05124
MMPHDQGIQTGVIITTALATFVAGFLFGIYTSRGYLISPALTDERRHNLVDPVESEESDVDEGTSLLDHAPNWAN
GPAADRKQGLLVDKGGEECKLVLVVRTDLGMTKGKIAAQCSHATLACYKALARTALSSPQRTLLSRWERSGQAKI
ALQAKSEAEVRELRGQALARGLPAEMVQDAGRTQIEAGSLTVLGIGPAPRSLVDEVTGHLKLL*
Coding >Ophcf2|05124
ATGATGCCCCACGATCAAGGCATCCAAACAGGCGTCATCATCACCACCGCGCTGGCCACCTTCGTCGCAGGCTTC
CTCTTCGGAATCTACACCTCTCGCGGCTACCTGATTTCGCCGGCGCTGACGGACGAGCGTCGCCATAACCTCGTC
GATCCGGTTGAGAGTGAGGAGAGCGACGTCGACGAGGGGACTTCGCTGCTTGATCATGCGCCTAATTGGGCCAAC
GGGCCTGCTGCGGATCGGAAGCAGGGGCTGCTCGTTGATAAGGGGGGGGAGGAGTGTAAGCTTGTTTTGGTGGTG
AGGACGGATCTGGGCATGACCAAAGGAAAAATCGCCGCTCAATGCTCCCACGCAACCCTCGCCTGCTACAAAGCC
CTCGCCCGCACAGCCCTCTCGTCACCGCAACGCACGCTGCTCTCCCGCTGGGAGCGCAGCGGACAAGCCAAGATC
GCGCTGCAGGCCAAGAGCGAGGCCGAGGTTCGCGAGCTGAGGGGCCAGGCCTTGGCTAGGGGCTTGCCTGCTGAG
ATGGTGCAGGATGCGGGCAGGACGCAGATTGAGGCGGGTAGCTTGACGGTTTTGGGAATTGGGCCTGCGCCTAGG
AGCTTGGTTGATGAGGTTACGGGGCATTTGAAGCTGTTGTAG
Transcript >Ophcf2|05124
ATGATGCCCCACGATCAAGGCATCCAAACAGGCGTCATCATCACCACCGCGCTGGCCACCTTCGTCGCAGGCTTC
CTCTTCGGAATCTACACCTCTCGCGGCTACCTGATTTCGCCGGCGCTGACGGACGAGCGTCGCCATAACCTCGTC
GATCCGGTTGAGAGTGAGGAGAGCGACGTCGACGAGGGGACTTCGCTGCTTGATCATGCGCCTAATTGGGCCAAC
GGGCCTGCTGCGGATCGGAAGCAGGGGCTGCTCGTTGATAAGGGGGGGGAGGAGTGTAAGCTTGTTTTGGTGGTG
AGGACGGATCTGGGCATGACCAAAGGAAAAATCGCCGCTCAATGCTCCCACGCAACCCTCGCCTGCTACAAAGCC
CTCGCCCGCACAGCCCTCTCGTCACCGCAACGCACGCTGCTCTCCCGCTGGGAGCGCAGCGGACAAGCCAAGATC
GCGCTGCAGGCCAAGAGCGAGGCCGAGGTTCGCGAGCTGAGGGGCCAGGCCTTGGCTAGGGGCTTGCCTGCTGAG
ATGGTGCAGGATGCGGGCAGGACGCAGATTGAGGCGGGTAGCTTGACGGTTTTGGGAATTGGGCCTGCGCCTAGG
AGCTTGGTTGATGAGGTTACGGGGCATTTGAAGCTGTTGTAG
Gene >Ophcf2|05124
ATGATGCCCCACGATCAAGGCATCCAAACAGGCGTCATCATCACCACCGCGCTGGCCACCTTCGTCGCAGGCTTC
CTCTTCGGAATCTACACCTCTCGCGGCTACCTGATTTCGCCGGCGCTGACGGACGAGCGTCGCCATAACCTCGTC
GATCCGGTTGAGAGTGAGGAGAGCGACGTCGACGAGGGGACTTCGCTGCTTGATCATGCGCCTAATTGGGCCAAC
GGGCCTGCTGCGGATCGGAAGCAGGGGCTGCTCGTTGATAAGGGGGGGGAGGAGTGTAAGCTTGTTTTGGTGGTG
AGGACGGATCTGGGCATGACCAAAGGTATCCTTCCCTCGCCCCCCCCTTTCCCCCATCCAAGGCAACCGACTCGA
ACGCTAAGAACGCGAACCTCACAGGAAAAATCGCCGCTCAATGCTCCCACGCAACCCTCGCCTGCTACAAAGCCC
TCGCCCGCACAGCCCTCTCGTCACCGCAACGCACGCTGCTCTCCCGCTGGGAGCGCAGCGGACAAGCCAAGATCG
CGCTGCAGGCCAAGAGCGAGGCCGAGGTTCGCGAGCTGAGGGGCCAGGCCTTGGCTAGGGGCTTGCCTGCTGAGA
TGGTGCAGGATGCGGGCAGGACGCAGATTGAGGCGGGTAGCTTGACGGTTTTGGGAATTGGGCCTGCGCCTAGGA
GCTTGGTTGATGAGGTTACGGGGCATTTGAAGCTGTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail