Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05122
Gene name
Locationscaffold_05:2557274..2559702
Strand-
Gene length (bp)2428
Transcript length (bp)2364
Coding sequence length (bp)2364
Protein length (aa) 788

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04950 RIBIOP_C 40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal 2.5E-105 488 779
PF08142 AARP2CN AARP2CN (NUC121) domain 3.4E-16 231 305

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0042254 ribosome biogenesis Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0044085 cellular component biogenesis No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3841 0.8803 0.0081 0.0102 0.1429 0.0387 0.0696 0.029 0.0388 0.0026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4702
Ophiocordyceps australis map64 (Brazil) OphauB2|6288
Ophiocordyceps camponoti-floridani Ophcf2|05122 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7517
Ophiocordyceps kimflemingae Ophio5|2964
Ophiocordyceps subramaniannii Hirsu2|10248

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05122
MPVAVTPHSHRPTTKVAHKPFKSKAASKHELRDRAKGRAPNERGQRKTPQQQVMSKLDRRNQAKQFRLSKHKEHV
KETSIFSGRDGAPRIVSVIPLCADGDAKAAIYRLIDSLDIEASISDGSTRVSVDRFKQKIQYLPLTRELDSCLDA
ARVSDFVVVILSASEEVDALGELILRSVEGQGLSTLFTVVQGIENVEPAKQKQAVLGSLKSFITHFHPEQDKVYS
LDSRQECSNLMRSLCNTTPKGVRWRDERSWMLADDVDVARDDSDCTIITGVVRGRALNADRLVQVGDWGAFRIRK
IVAAPIPQQTKRGEAMVEDRDEEAVLALPSGDQDDLEELAPDDVLMDSYDDGAQSAVASTKKGVLLDDHHYFSDE
EEEEAKRQMAKRRLPKGTSSYQAAWYLDDVSDSGSDLDHVEMGEGDRSDEVIGAEDGIEGYAAPEPTEAGPSEYP
QSVNMEEPDEADDAQQLARYRARKRDEADDKEFPDELELHPNVVARERLARYRGLKSVRTSPWQEDEDRAHEPTW
WRRLLQIPDYQASRSRATREALVGGVAAGTRVRIYVERVPAEARASWRPDRPLTMVGLLRHEHKKTAVNYLLNLS
TDSDSDESLKSKDEVMIQCGARRMTVRPILSQSGSTANDVHKYCRFLHPGQSAMATFVGPVTWGAVPVLFFRRSS
SGAGLKLIGTGTALPPSTSRVVAKRVILTGHPFHIHKKMVTVRYMFFSREDVEWFKALPLWTRRGRSGYIKEALG
THGYFKATFDGRVNPQDAVGVSLYKRVWPREAVMGGV*
Coding >Ophcf2|05122
ATGCCTGTCGCCGTGACGCCTCACTCGCACCGTCCTACCACAAAGGTGGCGCATAAGCCGTTCAAGTCCAAGGCT
GCGTCTAAGCATGAGCTGAGGGACCGGGCCAAAGGCCGAGCGCCCAATGAGCGCGGTCAGCGAAAGACTCCGCAA
CAGCAGGTCATGTCCAAGCTCGATAGACGCAACCAGGCCAAACAGTTCCGGTTGTCCAAGCACAAGGAGCACGTC
AAGGAGACTTCCATCTTCTCCGGTCGCGACGGGGCGCCTCGGATTGTCAGCGTCATTCCTCTGTGCGCCGACGGC
GATGCCAAGGCTGCTATTTACCGTCTGATTGACAGCCTGGATATCGAAGCTAGCATCTCCGACGGCAGCACGAGA
GTCTCGGTCGACCGCTTCAAGCAGAAGATACAATATCTACCGCTTACGCGAGAGCTCGATTCATGTCTGGACGCT
GCGCGAGTGTCAGACTTCGTCGTCGTCATTCTGTCCGCCAGTGAAGAAGTTGATGCCCTCGGAGAGCTCATCCTC
CGCAGTGTCGAGGGCCAGGGGCTATCGACTCTCTTCACCGTGGTTCAGGGCATCGAGAATGTCGAGCCTGCGAAG
CAGAAGCAGGCCGTCCTCGGTTCCCTCAAGTCCTTTATCACGCACTTTCACCCAGAGCAGGATAAAGTCTACAGC
TTGGACAGCCGACAAGAGTGCTCCAACCTGATGCGCTCCCTCTGCAACACGACACCCAAGGGAGTGAGGTGGAGG
GACGAAAGGAGCTGGATGTTGGCCGATGACGTCGACGTCGCCCGCGACGATTCTGATTGTACAATCATCACGGGC
GTGGTTCGAGGCCGTGCGCTGAATGCGGATCGCTTGGTACAAGTCGGCGACTGGGGCGCCTTTAGGATACGCAAG
ATTGTCGCCGCCCCTATACCGCAACAGACGAAACGGGGCGAGGCCATGGTCGAGGACAGAGACGAGGAGGCCGTT
CTGGCCTTACCGTCCGGAGACCAGGATGATCTGGAAGAGCTGGCGCCTGACGACGTTTTGATGGATTCGTACGAC
GACGGCGCTCAATCGGCTGTGGCTTCGACAAAGAAGGGCGTGCTTCTCGATGATCACCATTACTTCTCCGACGAG
GAGGAGGAAGAGGCCAAGAGACAGATGGCCAAGAGGCGGCTGCCTAAGGGTACGTCAAGCTATCAGGCAGCTTGG
TATCTCGACGACGTTTCGGATTCCGGTTCGGACCTGGACCATGTCGAGATGGGCGAAGGCGATAGATCGGACGAG
GTAATTGGCGCCGAGGACGGCATCGAAGGCTACGCGGCGCCCGAGCCTACGGAAGCCGGCCCTTCGGAGTACCCC
CAGTCGGTCAACATGGAGGAGCCAGACGAGGCCGACGACGCCCAGCAGCTGGCCCGATACCGAGCCCGCAAGCGA
GACGAGGCAGACGACAAGGAGTTCCCAGACGAACTGGAACTGCACCCCAACGTCGTGGCACGGGAGCGGCTGGCA
CGGTACCGAGGCCTCAAGAGCGTGCGGACCAGCCCCTGGCAAGAGGACGAAGACCGGGCGCACGAACCGACGTGG
TGGAGGCGTCTCCTCCAGATCCCGGATTATCAGGCATCGCGGTCGCGGGCGACTCGCGAGGCGTTGGTCGGGGGC
GTCGCGGCCGGGACCCGGGTCCGGATCTACGTCGAGCGGGTGCCGGCCGAGGCGCGGGCATCGTGGCGTCCGGAC
CGTCCGCTGACGATGGTCGGGCTGCTCCGGCACGAGCACAAGAAGACGGCGGTCAACTACCTGCTCAACCTCTCT
ACGGATTCCGACTCGGACGAATCGCTAAAGTCCAAAGACGAAGTCATGATTCAGTGCGGCGCGCGACGAATGACG
GTTCGACCCATCCTCTCGCAATCCGGCTCGACAGCCAACGACGTGCACAAATACTGCCGCTTCCTACACCCAGGC
CAATCCGCCATGGCAACATTTGTCGGCCCCGTGACGTGGGGCGCCGTCCCCGTCCTCTTCTTCCGGCGGTCGTCA
TCAGGTGCGGGCTTGAAGCTGATAGGCACGGGCACGGCTCTCCCGCCGTCAACATCACGGGTGGTAGCCAAACGC
GTCATCCTCACGGGCCATCCCTTCCACATCCATAAGAAGATGGTGACGGTGCGGTACATGTTCTTTAGCCGCGAG
GATGTGGAGTGGTTCAAGGCGTTGCCGCTTTGGACGAGGAGGGGGAGGTCTGGGTATATCAAGGAGGCGCTTGGG
ACGCATGGCTATTTCAAGGCTACCTTTGATGGGAGGGTGAATCCTCAGGATGCGGTGGGGGTCAGTTTGTATAAG
CGGGTTTGGCCGCGTGAGGCGGTCATGGGAGGGGTGTAG
Transcript >Ophcf2|05122
ATGCCTGTCGCCGTGACGCCTCACTCGCACCGTCCTACCACAAAGGTGGCGCATAAGCCGTTCAAGTCCAAGGCT
GCGTCTAAGCATGAGCTGAGGGACCGGGCCAAAGGCCGAGCGCCCAATGAGCGCGGTCAGCGAAAGACTCCGCAA
CAGCAGGTCATGTCCAAGCTCGATAGACGCAACCAGGCCAAACAGTTCCGGTTGTCCAAGCACAAGGAGCACGTC
AAGGAGACTTCCATCTTCTCCGGTCGCGACGGGGCGCCTCGGATTGTCAGCGTCATTCCTCTGTGCGCCGACGGC
GATGCCAAGGCTGCTATTTACCGTCTGATTGACAGCCTGGATATCGAAGCTAGCATCTCCGACGGCAGCACGAGA
GTCTCGGTCGACCGCTTCAAGCAGAAGATACAATATCTACCGCTTACGCGAGAGCTCGATTCATGTCTGGACGCT
GCGCGAGTGTCAGACTTCGTCGTCGTCATTCTGTCCGCCAGTGAAGAAGTTGATGCCCTCGGAGAGCTCATCCTC
CGCAGTGTCGAGGGCCAGGGGCTATCGACTCTCTTCACCGTGGTTCAGGGCATCGAGAATGTCGAGCCTGCGAAG
CAGAAGCAGGCCGTCCTCGGTTCCCTCAAGTCCTTTATCACGCACTTTCACCCAGAGCAGGATAAAGTCTACAGC
TTGGACAGCCGACAAGAGTGCTCCAACCTGATGCGCTCCCTCTGCAACACGACACCCAAGGGAGTGAGGTGGAGG
GACGAAAGGAGCTGGATGTTGGCCGATGACGTCGACGTCGCCCGCGACGATTCTGATTGTACAATCATCACGGGC
GTGGTTCGAGGCCGTGCGCTGAATGCGGATCGCTTGGTACAAGTCGGCGACTGGGGCGCCTTTAGGATACGCAAG
ATTGTCGCCGCCCCTATACCGCAACAGACGAAACGGGGCGAGGCCATGGTCGAGGACAGAGACGAGGAGGCCGTT
CTGGCCTTACCGTCCGGAGACCAGGATGATCTGGAAGAGCTGGCGCCTGACGACGTTTTGATGGATTCGTACGAC
GACGGCGCTCAATCGGCTGTGGCTTCGACAAAGAAGGGCGTGCTTCTCGATGATCACCATTACTTCTCCGACGAG
GAGGAGGAAGAGGCCAAGAGACAGATGGCCAAGAGGCGGCTGCCTAAGGGTACGTCAAGCTATCAGGCAGCTTGG
TATCTCGACGACGTTTCGGATTCCGGTTCGGACCTGGACCATGTCGAGATGGGCGAAGGCGATAGATCGGACGAG
GTAATTGGCGCCGAGGACGGCATCGAAGGCTACGCGGCGCCCGAGCCTACGGAAGCCGGCCCTTCGGAGTACCCC
CAGTCGGTCAACATGGAGGAGCCAGACGAGGCCGACGACGCCCAGCAGCTGGCCCGATACCGAGCCCGCAAGCGA
GACGAGGCAGACGACAAGGAGTTCCCAGACGAACTGGAACTGCACCCCAACGTCGTGGCACGGGAGCGGCTGGCA
CGGTACCGAGGCCTCAAGAGCGTGCGGACCAGCCCCTGGCAAGAGGACGAAGACCGGGCGCACGAACCGACGTGG
TGGAGGCGTCTCCTCCAGATCCCGGATTATCAGGCATCGCGGTCGCGGGCGACTCGCGAGGCGTTGGTCGGGGGC
GTCGCGGCCGGGACCCGGGTCCGGATCTACGTCGAGCGGGTGCCGGCCGAGGCGCGGGCATCGTGGCGTCCGGAC
CGTCCGCTGACGATGGTCGGGCTGCTCCGGCACGAGCACAAGAAGACGGCGGTCAACTACCTGCTCAACCTCTCT
ACGGATTCCGACTCGGACGAATCGCTAAAGTCCAAAGACGAAGTCATGATTCAGTGCGGCGCGCGACGAATGACG
GTTCGACCCATCCTCTCGCAATCCGGCTCGACAGCCAACGACGTGCACAAATACTGCCGCTTCCTACACCCAGGC
CAATCCGCCATGGCAACATTTGTCGGCCCCGTGACGTGGGGCGCCGTCCCCGTCCTCTTCTTCCGGCGGTCGTCA
TCAGGTGCGGGCTTGAAGCTGATAGGCACGGGCACGGCTCTCCCGCCGTCAACATCACGGGTGGTAGCCAAACGC
GTCATCCTCACGGGCCATCCCTTCCACATCCATAAGAAGATGGTGACGGTGCGGTACATGTTCTTTAGCCGCGAG
GATGTGGAGTGGTTCAAGGCGTTGCCGCTTTGGACGAGGAGGGGGAGGTCTGGGTATATCAAGGAGGCGCTTGGG
ACGCATGGCTATTTCAAGGCTACCTTTGATGGGAGGGTGAATCCTCAGGATGCGGTGGGGGTCAGTTTGTATAAG
CGGGTTTGGCCGCGTGAGGCGGTCATGGGAGGGGTGTAG
Gene >Ophcf2|05122
ATGCCTGTCGCCGTGACGCCTCACTCGCACCGTCCTACCACAAAGGTGGCGCATAAGCCGTTCAAGTCCAAGGCT
GCGTCTAAGCATGAGCTGAGGGACCGGGCCAAAGGTCCATGATGCTATCCGATTGCGCTTCCGCGGGAACTCGGC
TAACATCAGCTCGACTCTCGCAGGCCGAGCGCCCAATGAGCGCGGTCAGCGAAAGACTCCGCAACAGCAGGTCAT
GTCCAAGCTCGATAGACGCAACCAGGCCAAACAGTTCCGGTTGTCCAAGCACAAGGAGCACGTCAAGGAGACTTC
CATCTTCTCCGGTCGCGACGGGGCGCCTCGGATTGTCAGCGTCATTCCTCTGTGCGCCGACGGCGATGCCAAGGC
TGCTATTTACCGTCTGATTGACAGCCTGGATATCGAAGCTAGCATCTCCGACGGCAGCACGAGAGTCTCGGTCGA
CCGCTTCAAGCAGAAGATACAATATCTACCGCTTACGCGAGAGCTCGATTCATGTCTGGACGCTGCGCGAGTGTC
AGACTTCGTCGTCGTCATTCTGTCCGCCAGTGAAGAAGTTGATGCCCTCGGAGAGCTCATCCTCCGCAGTGTCGA
GGGCCAGGGGCTATCGACTCTCTTCACCGTGGTTCAGGGCATCGAGAATGTCGAGCCTGCGAAGCAGAAGCAGGC
CGTCCTCGGTTCCCTCAAGTCCTTTATCACGCACTTTCACCCAGAGCAGGATAAAGTCTACAGCTTGGACAGCCG
ACAAGAGTGCTCCAACCTGATGCGCTCCCTCTGCAACACGACACCCAAGGGAGTGAGGTGGAGGGACGAAAGGAG
CTGGATGTTGGCCGATGACGTCGACGTCGCCCGCGACGATTCTGATTGTACAATCATCACGGGCGTGGTTCGAGG
CCGTGCGCTGAATGCGGATCGCTTGGTACAAGTCGGCGACTGGGGCGCCTTTAGGATACGCAAGATTGTCGCCGC
CCCTATACCGCAACAGACGAAACGGGGCGAGGCCATGGTCGAGGACAGAGACGAGGAGGCCGTTCTGGCCTTACC
GTCCGGAGACCAGGATGATCTGGAAGAGCTGGCGCCTGACGACGTTTTGATGGATTCGTACGACGACGGCGCTCA
ATCGGCTGTGGCTTCGACAAAGAAGGGCGTGCTTCTCGATGATCACCATTACTTCTCCGACGAGGAGGAGGAAGA
GGCCAAGAGACAGATGGCCAAGAGGCGGCTGCCTAAGGGTACGTCAAGCTATCAGGCAGCTTGGTATCTCGACGA
CGTTTCGGATTCCGGTTCGGACCTGGACCATGTCGAGATGGGCGAAGGCGATAGATCGGACGAGGTAATTGGCGC
CGAGGACGGCATCGAAGGCTACGCGGCGCCCGAGCCTACGGAAGCCGGCCCTTCGGAGTACCCCCAGTCGGTCAA
CATGGAGGAGCCAGACGAGGCCGACGACGCCCAGCAGCTGGCCCGATACCGAGCCCGCAAGCGAGACGAGGCAGA
CGACAAGGAGTTCCCAGACGAACTGGAACTGCACCCCAACGTCGTGGCACGGGAGCGGCTGGCACGGTACCGAGG
CCTCAAGAGCGTGCGGACCAGCCCCTGGCAAGAGGACGAAGACCGGGCGCACGAACCGACGTGGTGGAGGCGTCT
CCTCCAGATCCCGGATTATCAGGCATCGCGGTCGCGGGCGACTCGCGAGGCGTTGGTCGGGGGCGTCGCGGCCGG
GACCCGGGTCCGGATCTACGTCGAGCGGGTGCCGGCCGAGGCGCGGGCATCGTGGCGTCCGGACCGTCCGCTGAC
GATGGTCGGGCTGCTCCGGCACGAGCACAAGAAGACGGCGGTCAACTACCTGCTCAACCTCTCTACGGATTCCGA
CTCGGACGAATCGCTAAAGTCCAAAGACGAAGTCATGATTCAGTGCGGCGCGCGACGAATGACGGTTCGACCCAT
CCTCTCGCAATCCGGCTCGACAGCCAACGACGTGCACAAATACTGCCGCTTCCTACACCCAGGCCAATCCGCCAT
GGCAACATTTGTCGGCCCCGTGACGTGGGGCGCCGTCCCCGTCCTCTTCTTCCGGCGGTCGTCATCAGGTGCGGG
CTTGAAGCTGATAGGCACGGGCACGGCTCTCCCGCCGTCAACATCACGGGTGGTAGCCAAACGCGTCATCCTCAC
GGGCCATCCCTTCCACATCCATAAGAAGATGGTGACGGTGCGGTACATGTTCTTTAGCCGCGAGGATGTGGAGTG
GTTCAAGGCGTTGCCGCTTTGGACGAGGAGGGGGAGGTCTGGGTATATCAAGGAGGCGCTTGGGACGCATGGCTA
TTTCAAGGCTACCTTTGATGGGAGGGTGAATCCTCAGGATGCGGTGGGGGTCAGTTTGTATAAGCGGGTTTGGCC
GCGTGAGGCGGTCATGGGAGGGGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail