Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05116
Gene name
Locationscaffold_05:2542710..2543805
Strand+
Gene length (bp)1095
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.85 30.19 81.52
Alive In ants, during behavior modification 78.57 43.42 113.73
Dead In ants, recently dead 92.93 52.50 133.35

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.083962 no
Alive Dead 0.347719 no
Dead Fungus 0.007326 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05116
MPLNARTRAAYRADEERDHALLTDTDRHRLLTASLPAPSEIPGLGRPPATAQSRSRLGLRRLLRSHLQLLVFALL
HGIFSVYIRIRQTVNLLSYRIASVIYYHHATPQYIRRDVVTLGRRPDHLSAILKSEPNQRAKANLERLVDETAEL
ATWCACAEIPMLSIYEKTGLLKKHIPKIHDAVMQKFTFYFADHQPTLSVTSPHQEEYSPPTMGQSERGHLKLHLI
SEQDGRESIVDLTRTLTEMSQKGKLSPRDISIELVDTELTEGIMPEPDLLILFGPYPELAGYPPWQIRLTEIFCL
RDNESFGYYVFLKALQKYAKARMRHGK*
Coding >Ophcf2|05116
ATGCCCCTGAACGCGCGCACCCGCGCTGCTTACAGGGCCGACGAGGAGCGGGATCACGCGCTCCTGACCGATACA
GATAGGCATAGGCTCCTCACTGCCAGTCTTCCCGCTCCCAGCGAGATCCCCGGCTTGGGCAGGCCACCCGCGACG
GCGCAGTCGAGGTCGCGGCTGGGTTTGAGACGCCTCCTCCGCAGCCATTTACAGCTGCTCGTCTTCGCTCTCCTG
CACGGAATATTCTCCGTATACATCCGCATACGCCAGACTGTCAACCTGTTGAGCTATCGGATCGCCTCTGTCATC
TACTATCACCATGCGACGCCGCAATACATACGGAGAGATGTGGTCACCCTCGGTCGGAGACCCGATCATCTGAGC
GCCATCCTGAAATCGGAGCCGAATCAGAGGGCCAAGGCCAACTTGGAACGTCTGGTCGACGAGACGGCCGAGCTT
GCTACCTGGTGCGCCTGCGCCGAGATCCCGATGCTGTCGATATACGAGAAAACAGGCCTTCTCAAGAAGCACATA
CCGAAGATACACGACGCCGTGATGCAAAAATTCACCTTTTACTTTGCCGACCATCAGCCGACGCTCTCCGTGACC
TCACCGCATCAGGAGGAATACTCGCCACCGACCATGGGACAAAGCGAACGAGGTCATCTGAAGCTCCACCTCATC
TCGGAACAGGACGGCAGGGAGTCCATCGTCGATCTAACGAGGACCCTGACGGAAATGTCTCAGAAGGGCAAGCTT
TCGCCCCGCGACATCTCTATCGAGCTGGTGGATACGGAGCTCACCGAAGGTATCATGCCTGAGCCCGATCTGCTC
ATCTTGTTCGGCCCTTATCCAGAACTCGCGGGCTACCCGCCCTGGCAGATCCGCCTAACCGAGATCTTTTGCTTG
CGAGACAACGAGAGTTTCGGCTACTACGTCTTTCTCAAGGCGCTGCAAAAGTACGCCAAGGCGCGGATGCGGCAC
GGTAAGTGA
Transcript >Ophcf2|05116
ATGCCCCTGAACGCGCGCACCCGCGCTGCTTACAGGGCCGACGAGGAGCGGGATCACGCGCTCCTGACCGATACA
GATAGGCATAGGCTCCTCACTGCCAGTCTTCCCGCTCCCAGCGAGATCCCCGGCTTGGGCAGGCCACCCGCGACG
GCGCAGTCGAGGTCGCGGCTGGGTTTGAGACGCCTCCTCCGCAGCCATTTACAGCTGCTCGTCTTCGCTCTCCTG
CACGGAATATTCTCCGTATACATCCGCATACGCCAGACTGTCAACCTGTTGAGCTATCGGATCGCCTCTGTCATC
TACTATCACCATGCGACGCCGCAATACATACGGAGAGATGTGGTCACCCTCGGTCGGAGACCCGATCATCTGAGC
GCCATCCTGAAATCGGAGCCGAATCAGAGGGCCAAGGCCAACTTGGAACGTCTGGTCGACGAGACGGCCGAGCTT
GCTACCTGGTGCGCCTGCGCCGAGATCCCGATGCTGTCGATATACGAGAAAACAGGCCTTCTCAAGAAGCACATA
CCGAAGATACACGACGCCGTGATGCAAAAATTCACCTTTTACTTTGCCGACCATCAGCCGACGCTCTCCGTGACC
TCACCGCATCAGGAGGAATACTCGCCACCGACCATGGGACAAAGCGAACGAGGTCATCTGAAGCTCCACCTCATC
TCGGAACAGGACGGCAGGGAGTCCATCGTCGATCTAACGAGGACCCTGACGGAAATGTCTCAGAAGGGCAAGCTT
TCGCCCCGCGACATCTCTATCGAGCTGGTGGATACGGAGCTCACCGAAGGTATCATGCCTGAGCCCGATCTGCTC
ATCTTGTTCGGCCCTTATCCAGAACTCGCGGGCTACCCGCCCTGGCAGATCCGCCTAACCGAGATCTTTTGCTTG
CGAGACAACGAGAGTTTCGGCTACTACGTCTTTCTCAAGGCGCTGCAAAAGTACGCCAAGGCGCGGATGCGGCAC
GGTAAGTGA
Gene >Ophcf2|05116
ATGCCCCTGAACGCGCGCACCCGCGCTGCTTACAGGGCCGACGAGGAGCGGGATCACGCGCTCCTGACCGATACA
GATAGGCATAGGCTCCTCACTGTCCGTCGCCGCTCTCTATGTGTTTCTTTTCGCTAGCAGCTGATCATCGAGCGA
GCAGGCCAGTCTTCCCGCTCCCAGCGAGATCCCCGGCTTGGGCAGGCCACCCGCGACGGCGCAGTCGAGGTCGCG
GCTGGGTTTGAGACGCCTCCTCCGCAGCCATTTACAGCTGCTCGTCTTCGCTCTCCTGCACGGAATATTCTCCGT
ATACATCCGCATACGCCAGACTGTCAACCTGTTGAGCTATCGGATCGCCTCTGTCATCTACTATCACCATGCGAC
GCCGCAATACATACGGAGAGATGTGGTCACCCTCGGTCGGAGACCCGATCATCTGAGCGCCATCCTGAAATCGGA
GCCGAATCAGAGGGCCAAGGCCAACTTGGAACGTCTGGTCGACGAGACGGCCGAGCTTGCTACCTGGTGCGCCTG
CGCCGAGATCCCGATGCTGTCGATATACGAGAAAACAGGTCGGCCATGGTTACACCCTGACGCTAAGCCTCTCCC
TAACACAAATACCTAGGCCTTCTCAAGAAGCACATACCGAAGATACACGACGCCGTGATGCAAAAATTCACCTTT
TACTTTGCCGACCATCAGCCGACGCTCTCCGTGACCTCACCGCATCAGGAGGAATACTCGCCACCGACCATGGGA
CAAAGCGAACGAGGTCATCTGAAGCTCCACCTCATCTCGGAACAGGACGGCAGGGAGTCCATCGTCGATCTAACG
AGGACCCTGACGGAAATGTCTCAGAAGGGCAAGCTTTCGCCCCGCGACATCTCTATCGAGCTGGTGGATACGGAG
CTCACCGAAGGTATCATGCCTGAGCCCGATCTGCTCATCTTGTTCGGCCCTTATCCAGAACTCGCGGGCTACCCG
CCCTGGCAGATCCGCCTAACCGAGATCTTTTGCTTGCGAGACAACGAGAGTTTCGGCTACTACGTCTTTCTCAAG
GCGCTGCAAAAGTACGCCAAGGCGCGGATGCGGCACGGTAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail