Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05115
Gene name
Locationscaffold_05:2539636..2542228
Strand-
Gene length (bp)2592
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07393 Sec10 Exocyst complex component Sec10 1.4E-219 108 839

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0006887 exocytosis Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0046903 secretion No
GO:0140352 export from cell No
GO:0016192 vesicle-mediated transport No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0032940 secretion by cell No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Golgi apparatus Signal peptide 0.5481 0.3744 0.5522 0.062 0.0221 0.0012 0.1692 0.3396 0.7089 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1583
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2869
Ophiocordyceps australis map64 (Brazil) OphauB2|2256
Ophiocordyceps camponoti-floridani Ophcf2|05115 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7511
Ophiocordyceps kimflemingae Ophio5|4374
Ophiocordyceps subramaniannii Hirsu2|12

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05115
MERPTSAAKSLYPKGPTFTLDTLSSKDFIVRDFVDSLTESAIPANRRSGTSQAVFDPKPLIRTFENALSQLDLLG
DELQEKESELLSQVRRAELQHNQTLDTLGHKLDQSMKSFEALDMSLNAGGVNLPDSNGRSDGGGNFAVQVGEKLE
ELDRKRRRAQDAIFLIQCWTEVSETGQLSSLEAIQRQGGAEDKVRCAVIARQLMRISQQLDPASWGRANDHRDGT
NGVGNVTRGHNTREILEKFCETLEQALLKQFNNSYRRQNYQDMMECAKVLYDFNGGASVIAVFVNQHQFFIDRDQ
LMSDEVTPDGQMWEALADPDSEPPAVEASLQSLVDEVKVVMQEESFIIKRAFPFYETVLTKFIQRVFQQSIQQRL
EKVLDKAETISSLAFLRSLHSSRSYISALIEDLKTHGLTEHPEPCSAQIAQALDQQIDDLFVPYMVGSSYMDREK
KSLEEMYGSLLFRFTIYHSRRKKAPTGFMASLAQQGTQLMASAKDAYLERLDSSDLTPMQKAMMLRVAGLQDKEN
NNEIEVTDEDGALSVPNAQRMLKWLAESVQRTLELGSRAETPKDMNVLQNLLLTNMGQVYIETSLEAAQVQATML
ENAKTEPDLSYLSALRPAVTVAALMERFVRTVLIHLAESNTTVRRSMEAQKKTAMDSIEKKTNDILKVSLDVITN
WTTKSLSGQKKQDFRPKDTELDFLQTPTCLSICTFLGRASGHAAKVIDGQNAEKFFSELALSIHQLLSDHFKKFQ
VNATGGLMVTQDIAKYVATMRDWPLSKDVAGAVELLTEIGSLFIVGPEALREKSRTLAPGQTGNRGKLSKADFRA
FVQRRDDSGSVGIQSVLAGL*
Coding >Ophcf2|05115
ATGGAGCGTCCCACCTCAGCGGCAAAGAGCCTCTATCCCAAGGGCCCTACTTTCACGCTGGACACGCTGTCGAGC
AAGGACTTCATCGTCCGTGACTTTGTCGACAGCTTGACGGAGAGCGCCATTCCGGCCAACCGTCGCTCCGGCACT
TCCCAGGCCGTCTTTGACCCTAAACCTCTGATACGGACCTTTGAGAATGCCCTGTCGCAACTCGACTTGCTCGGC
GACGAGCTACAGGAGAAGGAGTCGGAACTTCTCTCTCAGGTTCGGAGGGCCGAGTTACAACATAACCAGACGCTC
GACACGCTCGGCCACAAGCTCGATCAGTCCATGAAGTCGTTTGAAGCCCTGGACATGTCGCTCAACGCAGGAGGC
GTAAACTTACCCGATTCCAACGGCAGATCAGACGGAGGAGGCAACTTTGCCGTACAAGTCGGCGAGAAGCTCGAA
GAGCTCGATCGGAAGCGTCGCAGGGCCCAGGATGCCATCTTTCTCATCCAGTGCTGGACCGAGGTCAGCGAGACC
GGCCAGTTGTCGTCGCTCGAAGCCATCCAGCGACAGGGTGGCGCCGAGGACAAGGTTCGCTGTGCGGTAATCGCC
CGCCAGCTGATGAGGATCAGCCAACAGCTGGATCCCGCCTCCTGGGGACGCGCAAATGATCATCGTGACGGCACC
AACGGCGTGGGTAACGTTACCAGAGGACACAACACCCGCGAGATACTCGAAAAGTTTTGCGAGACGTTGGAGCAA
GCTCTGCTCAAGCAATTTAACAACAGCTACCGCCGGCAGAACTACCAGGACATGATGGAGTGTGCCAAGGTGCTG
TACGATTTCAACGGCGGTGCCAGCGTCATCGCCGTCTTTGTCAACCAGCACCAGTTCTTCATCGACCGCGACCAG
CTCATGAGCGACGAGGTGACGCCAGACGGCCAGATGTGGGAGGCCTTGGCCGATCCCGACTCGGAACCCCCTGCG
GTCGAGGCCAGCCTGCAATCGCTCGTCGACGAAGTCAAGGTTGTCATGCAGGAGGAGTCCTTCATCATCAAGCGA
GCGTTTCCCTTTTACGAGACGGTCTTGACCAAGTTTATCCAGCGCGTCTTCCAACAGTCTATCCAGCAGCGGCTG
GAAAAGGTTCTGGACAAGGCCGAGACGATATCCTCTCTGGCGTTTCTGAGGTCGCTACACTCTTCGAGGAGTTAC
ATCAGCGCCCTCATCGAGGACCTCAAGACGCATGGCCTGACGGAGCACCCAGAACCGTGTTCGGCGCAGATCGCG
CAGGCGCTCGACCAGCAGATTGACGACCTGTTTGTTCCCTACATGGTCGGCTCATCCTACATGGACCGCGAAAAG
AAGAGCCTCGAAGAGATGTACGGATCTCTGCTATTTCGGTTCACGATATACCACTCGAGGCGCAAGAAGGCCCCG
ACAGGCTTCATGGCCTCGCTGGCCCAACAGGGGACGCAGCTCATGGCTTCGGCCAAGGACGCCTACCTGGAGCGG
CTCGATTCGTCCGACTTGACGCCGATGCAAAAGGCCATGATGCTACGAGTCGCCGGCCTGCAGGACAAGGAGAAC
AACAACGAGATTGAGGTGACGGATGAGGACGGGGCGCTGAGCGTGCCCAACGCGCAGCGAATGCTCAAGTGGCTG
GCCGAGAGCGTCCAGCGCACTCTCGAGCTCGGTTCCAGAGCGGAGACGCCCAAGGACATGAACGTGCTTCAGAAC
CTACTGCTCACCAACATGGGCCAGGTCTACATCGAGACGTCGCTCGAGGCCGCGCAGGTGCAGGCTACCATGCTG
GAGAATGCAAAGACGGAGCCCGACCTCTCGTATCTGTCCGCCCTGCGGCCGGCGGTGACTGTGGCGGCCCTCATG
GAACGCTTCGTCCGTACCGTTCTCATCCACCTGGCCGAGTCCAACACGACAGTTCGGCGGAGCATGGAGGCGCAG
AAGAAGACGGCCATGGACTCGATCGAGAAGAAGACCAACGATATCCTCAAGGTGTCGCTCGACGTCATCACTAAT
TGGACGACCAAGTCTCTGAGCGGACAGAAGAAGCAGGACTTTCGGCCCAAGGACACGGAGCTCGATTTCCTGCAG
ACGCCAACGTGTCTGAGCATCTGCACCTTTCTCGGCCGCGCGAGCGGTCATGCTGCCAAGGTCATCGACGGGCAG
AACGCCGAAAAGTTCTTTAGCGAGCTGGCCCTGTCCATCCACCAGCTGCTATCGGACCACTTCAAGAAGTTTCAG
GTCAACGCCACGGGCGGCCTGATGGTGACGCAGGACATCGCCAAGTACGTGGCCACCATGAGGGACTGGCCGCTC
AGCAAGGACGTGGCCGGCGCCGTGGAGCTGCTGACGGAGATCGGCTCCCTCTTCATCGTCGGTCCCGAGGCCCTG
AGGGAGAAATCGAGGACGCTGGCGCCGGGACAGACGGGGAACAGGGGCAAGCTGTCCAAGGCCGACTTTCGTGCC
TTTGTTCAGCGGCGCGACGATTCTGGCTCGGTGGGCATCCAGAGTGTCCTGGCTGGCCTCTGA
Transcript >Ophcf2|05115
ATGGAGCGTCCCACCTCAGCGGCAAAGAGCCTCTATCCCAAGGGCCCTACTTTCACGCTGGACACGCTGTCGAGC
AAGGACTTCATCGTCCGTGACTTTGTCGACAGCTTGACGGAGAGCGCCATTCCGGCCAACCGTCGCTCCGGCACT
TCCCAGGCCGTCTTTGACCCTAAACCTCTGATACGGACCTTTGAGAATGCCCTGTCGCAACTCGACTTGCTCGGC
GACGAGCTACAGGAGAAGGAGTCGGAACTTCTCTCTCAGGTTCGGAGGGCCGAGTTACAACATAACCAGACGCTC
GACACGCTCGGCCACAAGCTCGATCAGTCCATGAAGTCGTTTGAAGCCCTGGACATGTCGCTCAACGCAGGAGGC
GTAAACTTACCCGATTCCAACGGCAGATCAGACGGAGGAGGCAACTTTGCCGTACAAGTCGGCGAGAAGCTCGAA
GAGCTCGATCGGAAGCGTCGCAGGGCCCAGGATGCCATCTTTCTCATCCAGTGCTGGACCGAGGTCAGCGAGACC
GGCCAGTTGTCGTCGCTCGAAGCCATCCAGCGACAGGGTGGCGCCGAGGACAAGGTTCGCTGTGCGGTAATCGCC
CGCCAGCTGATGAGGATCAGCCAACAGCTGGATCCCGCCTCCTGGGGACGCGCAAATGATCATCGTGACGGCACC
AACGGCGTGGGTAACGTTACCAGAGGACACAACACCCGCGAGATACTCGAAAAGTTTTGCGAGACGTTGGAGCAA
GCTCTGCTCAAGCAATTTAACAACAGCTACCGCCGGCAGAACTACCAGGACATGATGGAGTGTGCCAAGGTGCTG
TACGATTTCAACGGCGGTGCCAGCGTCATCGCCGTCTTTGTCAACCAGCACCAGTTCTTCATCGACCGCGACCAG
CTCATGAGCGACGAGGTGACGCCAGACGGCCAGATGTGGGAGGCCTTGGCCGATCCCGACTCGGAACCCCCTGCG
GTCGAGGCCAGCCTGCAATCGCTCGTCGACGAAGTCAAGGTTGTCATGCAGGAGGAGTCCTTCATCATCAAGCGA
GCGTTTCCCTTTTACGAGACGGTCTTGACCAAGTTTATCCAGCGCGTCTTCCAACAGTCTATCCAGCAGCGGCTG
GAAAAGGTTCTGGACAAGGCCGAGACGATATCCTCTCTGGCGTTTCTGAGGTCGCTACACTCTTCGAGGAGTTAC
ATCAGCGCCCTCATCGAGGACCTCAAGACGCATGGCCTGACGGAGCACCCAGAACCGTGTTCGGCGCAGATCGCG
CAGGCGCTCGACCAGCAGATTGACGACCTGTTTGTTCCCTACATGGTCGGCTCATCCTACATGGACCGCGAAAAG
AAGAGCCTCGAAGAGATGTACGGATCTCTGCTATTTCGGTTCACGATATACCACTCGAGGCGCAAGAAGGCCCCG
ACAGGCTTCATGGCCTCGCTGGCCCAACAGGGGACGCAGCTCATGGCTTCGGCCAAGGACGCCTACCTGGAGCGG
CTCGATTCGTCCGACTTGACGCCGATGCAAAAGGCCATGATGCTACGAGTCGCCGGCCTGCAGGACAAGGAGAAC
AACAACGAGATTGAGGTGACGGATGAGGACGGGGCGCTGAGCGTGCCCAACGCGCAGCGAATGCTCAAGTGGCTG
GCCGAGAGCGTCCAGCGCACTCTCGAGCTCGGTTCCAGAGCGGAGACGCCCAAGGACATGAACGTGCTTCAGAAC
CTACTGCTCACCAACATGGGCCAGGTCTACATCGAGACGTCGCTCGAGGCCGCGCAGGTGCAGGCTACCATGCTG
GAGAATGCAAAGACGGAGCCCGACCTCTCGTATCTGTCCGCCCTGCGGCCGGCGGTGACTGTGGCGGCCCTCATG
GAACGCTTCGTCCGTACCGTTCTCATCCACCTGGCCGAGTCCAACACGACAGTTCGGCGGAGCATGGAGGCGCAG
AAGAAGACGGCCATGGACTCGATCGAGAAGAAGACCAACGATATCCTCAAGGTGTCGCTCGACGTCATCACTAAT
TGGACGACCAAGTCTCTGAGCGGACAGAAGAAGCAGGACTTTCGGCCCAAGGACACGGAGCTCGATTTCCTGCAG
ACGCCAACGTGTCTGAGCATCTGCACCTTTCTCGGCCGCGCGAGCGGTCATGCTGCCAAGGTCATCGACGGGCAG
AACGCCGAAAAGTTCTTTAGCGAGCTGGCCCTGTCCATCCACCAGCTGCTATCGGACCACTTCAAGAAGTTTCAG
GTCAACGCCACGGGCGGCCTGATGGTGACGCAGGACATCGCCAAGTACGTGGCCACCATGAGGGACTGGCCGCTC
AGCAAGGACGTGGCCGGCGCCGTGGAGCTGCTGACGGAGATCGGCTCCCTCTTCATCGTCGGTCCCGAGGCCCTG
AGGGAGAAATCGAGGACGCTGGCGCCGGGACAGACGGGGAACAGGGGCAAGCTGTCCAAGGCCGACTTTCGTGCC
TTTGTTCAGCGGCGCGACGATTCTGGCTCGGTGGGCATCCAGAGTGTCCTGGCTGGCCTCTGA
Gene >Ophcf2|05115
ATGGAGCGTCCCACCTCAGCGGCAAAGAGCCTCTATCCCAAGGGCCCTACTTTCACGCTGGACACGCTGTCGAGC
AAGGACTTCATCGTCCGTGACTTTGTCGACAGCTTGACGGAGAGCGCCATTCCGGCCAACCGTCGCTCCGGCACT
TCCCAGGCCGTCTTTGACCCTAAACCTCTGATACGGACCTTTGAGAGTGGGTGGCCCGCGCCTCTATCCCACAGC
CGACAAGACTGACGTATCCCTCCAGATGCCCTGTCGCAACTCGACTTGCTCGGCGACGAGCTACAGGAGAAGGAG
TCGGAACTTCTCTCTCAGGTTCGGAGGGCCGAGTTACAACATAACCAGACGCTCGACACGCTCGGCCACAAGCTC
GATCAGTCCATGAAGTCGTTTGAAGCCCTGGACATGTCGCTCAACGCAGGAGGCGTAAACTTACCCGATTCCAAC
GGCAGATCAGACGGAGGAGGCAACTTTGCCGTACAAGTCGGCGAGAAGCTCGAAGAGCTCGATCGGAAGCGTCGC
AGGGCCCAGGATGCCATCTTTCTCATCCAGTGCTGGACCGAGGTCAGCGAGACCGGCCAGTTGTCGTCGCTCGAA
GCCATCCAGCGACAGGGTGGCGCCGAGGACAAGGTTCGCTGTGCGGTAATCGCCCGCCAGCTGATGAGGATCAGC
CAACAGCTGGATCCCGCCTCCTGGGGACGCGCAAATGATCATCGTGACGGCACCAACGGCGTGGGTAACGTTACC
AGAGGACACAACACCCGCGAGATACTCGAAAAGTTTTGCGAGACGTTGGAGCAAGCTCTGCTCAAGCAATTTAAC
AACAGCTACCGCCGGCAGAACTACCAGGACATGATGGAGTGTGCCAAGGTGCTGTACGATTTCAACGGCGGTGCC
AGCGTCATCGCCGTCTTTGTCAACCAGCACCAGTTCTTCATCGACCGCGACCAGCTCATGAGCGACGAGGTGACG
CCAGACGGCCAGATGTGGGAGGCCTTGGCCGATCCCGACTCGGAACCCCCTGCGGTCGAGGCCAGCCTGCAATCG
CTCGTCGACGAAGTCAAGGTTGTCATGCAGGAGGAGTCCTTCATCATCAAGCGAGCGTTTCCCTTTTACGAGACG
GTCTTGACCAAGTTTATCCAGCGCGTCTTCCAACAGTCTATCCAGCAGCGGCTGGAAAAGGTTCTGGACAAGGCC
GAGACGATATCCTCTCTGGCGTTTCTGAGGTCGCTACACTCTTCGAGGAGTTACATCAGCGCCCTCATCGAGGAC
CTCAAGACGCATGGCCTGACGGAGCACCCAGAACCGTGTTCGGCGCAGATCGCGCAGGCGCTCGACCAGCAGATT
GACGACCTGTTTGTTCCCTACATGGTCGGCTCATCCTACATGGACCGCGAAAAGAAGAGCCTCGAAGAGATGTAC
GGATCTCTGCTATTTCGGTTCACGATATACCACTCGAGGCGCAAGAAGGCCCCGACAGGCTTCATGGCCTCGCTG
GCCCAACAGGGGACGCAGCTCATGGCTTCGGCCAAGGACGCCTACCTGGAGCGGCTCGATTCGTCCGACTTGACG
CCGATGCAAAAGGCCATGATGCTACGAGTCGCCGGCCTGCAGGACAAGGAGAACAACAACGAGATTGAGGTGACG
GATGAGGACGGGGCGCTGAGCGTGCCCAACGCGCAGCGAATGCTCAAGTGGCTGGCCGAGAGCGTCCAGCGCACT
CTCGAGCTCGGTTCCAGAGCGGAGACGCCCAAGGACATGAACGTGCTTCAGAACCTACTGCTCACCAACATGGGC
CAGGTCTACATCGAGACGTCGCTCGAGGCCGCGCAGGTGCAGGCTACCATGCTGGAGAATGCAAAGACGGAGCCC
GACCTCTCGTATCTGTCCGCCCTGCGGCCGGCGGTGACTGTGGCGGCCCTCATGGAACGCTTCGTCCGTACCGTT
CTCATCCACCTGGCCGAGTCCAACACGACAGTTCGGCGGAGCATGGAGGCGCAGAAGAAGACGGCCATGGACTCG
ATCGAGAAGAAGACCAACGATATCCTCAAGGTGTCGCTCGACGTCATCACTAATTGGACGACCAAGTCTCTGAGC
GGACAGAAGAAGCAGGACTTTCGGCCCAAGGACACGGAGCTCGATTTCCTGCAGACGCCAACGTGTCTGAGCATC
TGCACCTTTCTCGGCCGCGCGAGCGGTCATGCTGCCAAGGTCATCGACGGGCAGAACGCCGAAAAGTTCTTTAGC
GAGCTGGCCCTGTCCATCCACCAGCTGCTATCGGACCACTTCAAGAAGTTTCAGGTCAACGCCACGGGCGGCCTG
ATGGTGACGCAGGACATCGCCAAGTACGTGGCCACCATGAGGGACTGGCCGCTCAGCAAGGACGTGGCCGGCGCC
GTGGAGCTGCTGACGGAGATCGGCTCCCTCTTCATCGTCGGTCCCGAGGCCCTGAGGGAGAAATCGAGGACGCTG
GCGCCGGGACAGACGGGGAACAGGGGCAAGCTGTCCAAGGCCGACTTTCGTGCCTTTGTTCAGCGGCGCGACGAT
TCTGGCTCGGTGGGCATCCAGAGTGTCCTGGCTGGCCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail