Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05114
Gene name
Locationscaffold_05:2538301..2539605
Strand+
Gene length (bp)1304
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01207 Dus Dihydrouridine synthase (Dus) 1.3E-40 27 312

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7054 0.6384 0.0796 0.0403 0.5292 0.0125 0.0628 0.1111 0.0654 0.009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1452
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2868
Ophiocordyceps australis map64 (Brazil) OphauB2|2255
Ophiocordyceps camponoti-floridani Ophcf2|05114 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7510
Ophiocordyceps kimflemingae Ophio5|4373
Ophiocordyceps subramaniannii Hirsu2|11

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05114
MASAPGNPHPLKLFDTAKKQDRFLHACAPMVRYSKLAFRQTVHKYGVDLCWTPMILAKEFNRNDTARDSDLTVST
LGAQPPTILQFGANSPLELSRAACLAAPFVAGVDLNCGCPQSWACAETLGAALMNRRELVRDMVVETRRRLGCDG
WHVGLEDDVESLRGRSVSVKIRVHRDLRKTMDFLDTVIGHPQNRLVDWITIHPRTRSTPSTTPIRTEALDILTQK
YASTLPILLSGDVFALSSLPFSAPSDAEARPSNTGISGFMSARGLLANPALFAGYSACPWEALETFMCNVARCPL
PFKLVSHHVSQMCGPGMGNDKSALLPKKERAELAHLDNMMDLVDFLDARIEEHTGRAGGMRRDL*
Coding >Ophcf2|05114
ATGGCCTCCGCCCCAGGAAATCCCCACCCCCTCAAGCTCTTCGACACAGCCAAGAAGCAAGATCGCTTCCTCCAC
GCATGCGCCCCCATGGTCCGCTACAGCAAGCTCGCCTTCCGCCAAACAGTGCACAAATACGGCGTCGATCTCTGT
TGGACCCCCATGATCCTAGCCAAGGAATTCAACCGCAACGACACCGCCCGAGACAGCGATCTCACAGTCTCAACC
CTCGGTGCCCAACCGCCAACCATCCTCCAATTCGGCGCGAATTCACCGCTTGAGCTCTCGCGCGCAGCGTGTCTG
GCAGCCCCCTTCGTCGCAGGCGTGGATCTCAACTGCGGGTGTCCCCAGTCGTGGGCCTGCGCTGAGACGCTCGGT
GCCGCGCTCATGAATCGTCGTGAACTGGTACGTGATATGGTGGTTGAGACTCGGCGGCGTCTTGGCTGCGATGGG
TGGCATGTTGGATTGGAGGATGACGTGGAGAGCCTTCGCGGCCGGAGTGTCAGCGTCAAGATTAGGGTGCATAGG
GATCTGCGCAAGACGATGGACTTCTTGGATACGGTTATAGGACACCCGCAGAACCGGCTCGTCGACTGGATCACC
ATTCATCCGCGCACACGAAGCACTCCATCCACGACACCCATCAGAACCGAAGCCCTCGATATCCTCACACAAAAG
TACGCCAGCACGCTTCCAATCCTCCTCTCCGGCGATGTCTTCGCCCTCTCTTCCCTGCCCTTCAGCGCCCCATCC
GACGCCGAAGCGCGGCCCAGCAACACGGGCATCAGCGGCTTCATGTCCGCACGTGGCCTCCTCGCCAACCCGGCC
CTCTTCGCCGGATACTCAGCCTGTCCTTGGGAGGCCCTCGAGACCTTCATGTGCAACGTCGCTCGCTGTCCACTC
CCTTTCAAGCTCGTGTCTCACCACGTGTCGCAAATGTGCGGGCCCGGTATGGGTAACGACAAGTCTGCGCTGCTG
CCCAAGAAAGAGAGGGCCGAGCTCGCCCATCTGGACAACATGATGGATCTCGTCGACTTTCTCGACGCCAGGATA
GAGGAGCACACCGGTAGAGCGGGCGGAATGCGGCGCGATCTGTGA
Transcript >Ophcf2|05114
ATGGCCTCCGCCCCAGGAAATCCCCACCCCCTCAAGCTCTTCGACACAGCCAAGAAGCAAGATCGCTTCCTCCAC
GCATGCGCCCCCATGGTCCGCTACAGCAAGCTCGCCTTCCGCCAAACAGTGCACAAATACGGCGTCGATCTCTGT
TGGACCCCCATGATCCTAGCCAAGGAATTCAACCGCAACGACACCGCCCGAGACAGCGATCTCACAGTCTCAACC
CTCGGTGCCCAACCGCCAACCATCCTCCAATTCGGCGCGAATTCACCGCTTGAGCTCTCGCGCGCAGCGTGTCTG
GCAGCCCCCTTCGTCGCAGGCGTGGATCTCAACTGCGGGTGTCCCCAGTCGTGGGCCTGCGCTGAGACGCTCGGT
GCCGCGCTCATGAATCGTCGTGAACTGGTACGTGATATGGTGGTTGAGACTCGGCGGCGTCTTGGCTGCGATGGG
TGGCATGTTGGATTGGAGGATGACGTGGAGAGCCTTCGCGGCCGGAGTGTCAGCGTCAAGATTAGGGTGCATAGG
GATCTGCGCAAGACGATGGACTTCTTGGATACGGTTATAGGACACCCGCAGAACCGGCTCGTCGACTGGATCACC
ATTCATCCGCGCACACGAAGCACTCCATCCACGACACCCATCAGAACCGAAGCCCTCGATATCCTCACACAAAAG
TACGCCAGCACGCTTCCAATCCTCCTCTCCGGCGATGTCTTCGCCCTCTCTTCCCTGCCCTTCAGCGCCCCATCC
GACGCCGAAGCGCGGCCCAGCAACACGGGCATCAGCGGCTTCATGTCCGCACGTGGCCTCCTCGCCAACCCGGCC
CTCTTCGCCGGATACTCAGCCTGTCCTTGGGAGGCCCTCGAGACCTTCATGTGCAACGTCGCTCGCTGTCCACTC
CCTTTCAAGCTCGTGTCTCACCACGTGTCGCAAATGTGCGGGCCCGGTATGGGTAACGACAAGTCTGCGCTGCTG
CCCAAGAAAGAGAGGGCCGAGCTCGCCCATCTGGACAACATGATGGATCTCGTCGACTTTCTCGACGCCAGGATA
GAGGAGCACACCGGTAGAGCGGGCGGAATGCGGCGCGATCTGTGA
Gene >Ophcf2|05114
ATGGCCTCCGCCCCAGGAAATCCCCAGTACGATAAACCCCCCAACCCCCTAATCCCCAACTCTAACCCCCAAAAA
GCCCCCTCAAGCTCTTCGACACAGCCAAGAAGCAAGATCGCTTCCTCCACGCATGCGCCCCCATGGTCCGCTACA
GCAAGGCTCGTCCCCTTCAGCCCCCCAACAACCTACATAGGCTTACACCTTGTAGCTCGCCTTCCGCCAAACAGT
GCACAAATACGGCGTCGATCTCTGTTGGACCCCCATGATCCTAGCCAAGGAATTCAACCGCAACGACACCGCCCG
AGACAGCGGTATGCTCCTCCCCCCCTTGGAAAAGCAAGGAACATCTAACAGCATCGCAGATCTCACAGTCTCAAC
CCTCGGTGCCCAACCGCCAACCATCCTCCAATTCGGCGCGAATTCACCGCTTGAGCTCTCGCGCGCAGCGTGTCT
GGCAGCCCCCTTCGTCGCAGGCGTGGATCTCAACTGCGGGTGTCCCCAGTCGTGGGCCTGCGCTGAGACGCTCGG
TGCCGCGCTCATGAATCGTCGTGAACTGGTACGTGATATGGTGGTTGAGACTCGGCGGCGTCTTGGCTGCGATGG
GTGGCATGTTGGATTGGAGGATGACGTGGAGAGCCTTCGCGGCCGGAGTGTCAGCGTCAAGATTAGGGTGCATAG
GGATCTGCGGTCCGTTGTCACGCCCTTGGGAAAGAAGTCTCTTTCCGCGTTTCTGACGCTGAGCCAGCAAGACGA
TGGACTTCTTGGATACGGTTATAGGACACCCGCAGAACCGGCTCGTCGACTGGATCACCATTCATCCGCGCACAC
GAAGCACTCCATCCACGACACCCATCAGAACCGAAGCCCTCGATATCCTCACACAAAAGTACGCCAGCACGCTTC
CAATCCTCCTCTCCGGCGATGTCTTCGCCCTCTCTTCCCTGCCCTTCAGCGCCCCATCCGACGCCGAAGCGCGGC
CCAGCAACACGGGCATCAGCGGCTTCATGTCCGCACGTGGCCTCCTCGCCAACCCGGCCCTCTTCGCCGGATACT
CAGCCTGTCCTTGGGAGGCCCTCGAGACCTTCATGTGCAACGTCGCTCGCTGTCCACTCCCTTTCAAGCTCGTGT
CTCACCACGTGTCGCAAATGTGCGGGCCCGGTATGGGTAACGACAAGTCTGCGCTGCTGCCCAAGAAAGAGAGGG
CCGAGCTCGCCCATCTGGACAACATGATGGATCTCGTCGACTTTCTCGACGCCAGGATAGAGGAGCACACCGGTA
GAGCGGGCGGAATGCGGCGCGATCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail