Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05112
Gene name
Locationscaffold_05:2536174..2536538
Strand-
Gene length (bp)364
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 4.2E-16 8 66
PF13233 Complex1_LYR_2 Complex1_LYR-like 3.8E-07 10 57

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2274 0.1431 0.0214 0.038 0.9586 0.0211 0.0112 0.0274 0.0295 0.008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6267
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2865
Ophiocordyceps australis map64 (Brazil) OphauB2|2252
Ophiocordyceps camponoti-floridani Ophcf2|05112 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05112
MRLSGLQKDVLSLYRQCLRASRQKPKGARSHFEAFVRAEFTRNINIDKRNFDFIEFLLRRGRRQLQVYSSPGVKD
VR*
Coding >Ophcf2|05112
ATGCGTCTCTCAGGCCTCCAAAAAGACGTCCTCTCCTTATATCGCCAATGTCTCCGTGCCAGCCGTCAGAAGCCA
AAGGGCGCCCGCTCTCACTTCGAAGCCTTCGTCAGAGCCGAGTTCACCCGCAACATAAACATTGACAAGCGCAAC
TTTGATTTCATCGAGTTCCTGCTGCGTCGAGGCCGAAGACAGCTCCAAGTTTACTCCTCGCCCGGCGTCAAAGAT
GTCAGGTGA
Transcript >Ophcf2|05112
ATGCGTCTCTCAGGCCTCCAAAAAGACGTCCTCTCCTTATATCGCCAATGTCTCCGTGCCAGCCGTCAGAAGCCA
AAGGGCGCCCGCTCTCACTTCGAAGCCTTCGTCAGAGCCGAGTTCACCCGCAACATAAACATTGACAAGCGCAAC
TTTGATTTCATCGAGTTCCTGCTGCGTCGAGGCCGAAGACAGCTCCAAGTTTACTCCTCGCCCGGCGTCAAAGAT
GTCAGGTGA
Gene >Ophcf2|05112
ATGCGTCTCTCAGGCCTCCAAAAAGACGTCCTCTCCTTATATCGCCAATGTCTCCGTGCCAGCCGTCAGAAGCCA
AAGGTGTGTCTATCTAATTCGAGCCGCAGTTCTTCACTGACGTCAGTGACCAACGGCAGGGCGCCCGCTCTCACT
TCGAAGCCTTCGTCAGGTGAGCCGTCCTCGGCTGTTTTCCTCGTTCCGTACCTACCTACCTATACCAGAGTTGCT
CAAGTCACTCCGCAGAGCCGAGTTCACCCGCAACATAAACATTGACAAGCGCAACTTTGATTTCATCGAGTTCCT
GCTGCGTCGAGGCCGAAGACAGCTCCAAGTTTACTCCTCGCCCGGCGTCAAAGATGTCAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail