Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05109
Gene name
Locationscaffold_05:2530097..2530651
Strand-
Gene length (bp)554
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

Domain # Start End Length
1 97 119 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 56.37 24.95 87.80
Alive In ants, during behavior modification 92.75 45.72 139.78
Dead In ants, recently dead 92.13 45.71 138.54

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.027999 yes
Alive Dead 0.980072 no
Dead Fungus 0.027999 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05109
MDQDAWRDSLLDTFRANFSATHGRHLARCWSHQDCRGCLDHGGCSWCPFTWACVPNACPIPLLAPAYDARICPHP
AERWELRSRPFGCHVSTTTSLTAVVAVLATILIALLTLLNVSALKRYRRRAADKPDWSHDPDYAWRAVLLPPDAR
ERQPLLGDATAR*
Coding >Ophcf2|05109
ATGGACCAAGACGCTTGGAGGGATTCCCTTCTTGACACCTTCCGCGCCAACTTCTCGGCTACCCATGGCCGCCAC
CTCGCTCGATGCTGGTCTCACCAGGATTGCCGTGGCTGCTTGGATCATGGTGGATGCAGCTGGTGTCCCTTCACT
TGGGCTTGTGTCCCGAACGCCTGCCCGATTCCGCTTCTTGCTCCGGCATACGATGCCCGAATATGTCCTCATCCG
GCTGAGCGATGGGAACTTCGCTCGAGGCCCTTTGGCTGCCATGTCTCCACCACCACCAGTCTGACGGCCGTCGTA
GCCGTTCTGGCCACCATCCTCATCGCTCTATTGACCCTACTCAACGTCTCTGCTCTCAAACGATATCGTCGCCGT
GCCGCTGACAAGCCCGATTGGAGCCACGATCCCGACTACGCCTGGCGTGCCGTCCTGTTGCCTCCGGATGCCCGC
GAGCGACAACCGCTCCTGGGAGACGCGACCGCTCGTTGA
Transcript >Ophcf2|05109
ATGGACCAAGACGCTTGGAGGGATTCCCTTCTTGACACCTTCCGCGCCAACTTCTCGGCTACCCATGGCCGCCAC
CTCGCTCGATGCTGGTCTCACCAGGATTGCCGTGGCTGCTTGGATCATGGTGGATGCAGCTGGTGTCCCTTCACT
TGGGCTTGTGTCCCGAACGCCTGCCCGATTCCGCTTCTTGCTCCGGCATACGATGCCCGAATATGTCCTCATCCG
GCTGAGCGATGGGAACTTCGCTCGAGGCCCTTTGGCTGCCATGTCTCCACCACCACCAGTCTGACGGCCGTCGTA
GCCGTTCTGGCCACCATCCTCATCGCTCTATTGACCCTACTCAACGTCTCTGCTCTCAAACGATATCGTCGCCGT
GCCGCTGACAAGCCCGATTGGAGCCACGATCCCGACTACGCCTGGCGTGCCGTCCTGTTGCCTCCGGATGCCCGC
GAGCGACAACCGCTCCTGGGAGACGCGACCGCTCGTTGA
Gene >Ophcf2|05109
ATGGACCAAGACGCTTGGAGGGATTCCCTTCTTGACACCTTCCGCGCCAACTTCTCGGCTACCCATGGCCGCCAC
CTCGCTCGATGCTGGTCTCACCAGGATTGCCGTGGCTGCTTGGATCATGGTGGATGCAGCTGGTGTCCCTTCGTC
CGCATATCCCTCCTTCTCGCTTCCCAACCACCCTTCCTTTCGGCTGACCACGTGGGGCATAGACTTGGGCTTGTG
TCCCGAACGCCTGCCCGATTCCGCTTCTTGCTCCGGCATACGATGCCCGAATATGTCCTCATCCGGCTGAGCGAT
GGGAACTTCGCTCGAGGCCCTTTGGCTGCCATGTCTCCACCACCACCAGTCTGACGGCCGTCGTAGCCGTTCTGG
CCACCATCCTCATCGCTCTATTGACCCTACTCAACGTCTCTGCTCTCAAACGATATCGTCGCCGTGCCGCTGACA
AGCCCGATTGGAGCCACGATCCCGACTACGCCTGGCGTGCCGTCCTGTTGCCTCCGGATGCCCGCGAGCGACAAC
CGCTCCTGGGAGACGCGACCGCTCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail