Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05106
Gene name
Locationscaffold_05:2525857..2527369
Strand-
Gene length (bp)1512
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14474 RTC4 RTC4-like domain 2.3E-33 58 168

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.597 0.5156 0.1713 0.1142 0.327 0.0713 0.1598 0.0823 0.0852 0.0125

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2858
Ophiocordyceps australis map64 (Brazil) OphauB2|2247
Ophiocordyceps camponoti-floridani Ophcf2|05106 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7504
Ophiocordyceps kimflemingae Ophio5|2777
Ophiocordyceps subramaniannii Hirsu2|2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05106
MGKRQMNVRLLKRFCHKHKKKTAEEIWQAMKYPEVNWEGLVDRFKTHHSHLLGIIDGHESHYRNDLAAKIERGEA
RSMKKEGNLTPGYYGFRGFDLMCDYLVEEFGELLKRRAVKDRVIAGRGAAAFIQCVLVAELAVRLIRDDMGVSEN
KAREIMEESKAVGEMLHDGAVGDDEV*
Coding >Ophcf2|05106
ATGGGCAAGAGGCAGATGAATGTGCGGCTACTGAAAAGGTTTTGTCACAAGCACAAGAAAAAGACGGCCGAAGAG
ATTTGGCAGGCCATGAAGTACCCCGAGGTGAATTGGGAGGGCTTGGTGGACCGATTCAAGACGCATCACAGCCAT
CTCCTTGGAATCATCGACGGCCATGAATCGCATTACCGGAACGATCTAGCGGCCAAGATTGAGCGCGGAGAGGCT
AGGTCGATGAAGAAGGAGGGCAACTTGACCCCGGGATACTACGGGTTCCGGGGCTTTGATCTCATGTGCGACTAT
CTCGTCGAAGAGTTTGGCGAGCTACTCAAGCGCAGGGCCGTCAAAGATCGCGTCATTGCTGGTCGAGGAGCGGCG
GCCTTTATCCAGTGCGTTCTGGTGGCCGAACTGGCCGTGAGGCTCATTCGCGACGACATGGGCGTTTCGGAGAAC
AAGGCCAGGGAGATTATGGAGGAGAGTAAGGCGGTGGGGGAGATGCTTCACGATGGAGCGGTGGGAGACGATGAG
GTGTGA
Transcript >Ophcf2|05106
ATGGGCAAGAGGCAGATGAATGTGCGGCTACTGAAAAGGTTTTGTCACAAGCACAAGAAAAAGACGGCCGAAGAG
ATTTGGCAGGCCATGAAGTACCCCGAGGTGAATTGGGAGGGCTTGGTGGACCGATTCAAGACGCATCACAGCCAT
CTCCTTGGAATCATCGACGGCCATGAATCGCATTACCGGAACGATCTAGCGGCCAAGATTGAGCGCGGAGAGGCT
AGGTCGATGAAGAAGGAGGGCAACTTGACCCCGGGATACTACGGGTTCCGGGGCTTTGATCTCATGTGCGACTAT
CTCGTCGAAGAGTTTGGCGAGCTACTCAAGCGCAGGGCCGTCAAAGATCGCGTCATTGCTGGTCGAGGAGCGGCG
GCCTTTATCCAGTGCGTTCTGGTGGCCGAACTGGCCGTGAGGCTCATTCGCGACGACATGGGCGTTTCGGAGAAC
AAGGCCAGGGAGATTATGGAGGAGAGTAAGGCGGTGGGGGAGATGCTTCACGATGGAGCGGTGGGAGACGATGAG
GTGTGA
Gene >Ophcf2|05106
ATGGGCAAGAGGTTAGAACGACGAATTGGTATCTCTAACCATACGAGGGAGCCACTTCTAAAGACTATTGGCGGT
TCGACGTCAACGAGAAAGCAGTACGCCACCGCCAATCGCTCTAAACCACCGGCGAAAATACAGGTTGCCGACACC
GATCCTCCACTGTCCAGCGACGACGAAGACTGCACCGACAGCGTGGTCGACGGGACCCCCGACTCCAGACGAGGC
TCTCGGCTTGGCTCCCCGTCTCGGTCTTCTCAAGACCACCGCATTCCCAGCAGCTCTGGCGAAGAGGAAGCACCA
GAATCCGACATTCGACGAACCAGGTTTGGTCCAGGTCCCAAGTTGGGGAAACGGAAGCGGAAGGATCAAGCCAAG
GATTCGGCTGATGCGCCATCGAAAAGCTTCAGGTCGGTCGATATTTCCGCCCGACGGCGTCAGGAAGCATCTCAG
GCTTCAATCGCGGGCAGAAATGAGCGCCAATTACTACCTCCAAAGCCAAAGACGTCCACACAAACGTACGGGAAG
AAAAATGTGGCGAGATCAAGCCATTGTCCCGACAGGAGGAAAGGTGACGTTGTCAAGCCACAGAAACCAAGGGCT
CGGACGCCTACGGAATCAAAGGTTGAATTGCTGCCCCCCCCTGACTTGCCATCCTGCGATCTTTCTTCCAGCCCA
GAGAATGGCAAAGTCCCGTCCCTCAAGCTGAATGTACCTGCTTCGCCACCACGATCCCCAACCGGTCTGCTGGTG
CCTTCGAATTTCGCCAGTGAGTTGGTGGACAGTTCGCCGCGTGCAAAACGGGCTTCTATCAGGGTCCCCGCCGAT
GGCTATGGTCAAACGATAGACGCGATACTCTCCGACGGGGAAGAGCAAAAAGACGGCCCCCCACCCGTGTTCCAA
GTCGATTCGACTCCTCAAGCGGCCGTGACGGTGTGTCCATGGTGCGGCGAAGCCGTCGATAAGTCATCACTGGAT
GCTTTCTCCAAGGGCAGGCAGATGAATGTGCGGCTACTGAAAAGGTTTTGTCACAAGCACAAGAAAAAGACGGCC
GAAGAGATTTGGCAGGCCATGAAGTACCCCGAGGTGAATTGGGAGGGCTTGGTGGACCGATTCAAGACGCATCAC
AGCCATCTCCTTGGAATCATCGACGGCCATGAATCGCATTACCGGAACGATCTAGCGGCCAAGATTGAGCGCGGA
GAGGCTAGGTCGATGAAGAAGGAGGGCAACTTGACCCCGGGATACTACGGGTTCCGGGGCTTTGATCTCATGTGC
GACTATCTCGTCGAAGAGTTTGGCGAGCTACTCAAGCGCAGGGCCGTCAAAGATCGCGTCATTGCTGGTCGAGGA
GCGGCGGCCTTTATCCAGTGCGTTCTGGTGGCCGAACTGGCCGTGAGGCTCATTCGCGACGACATGGGCGTTTCG
GAGAACAAGGCCAGGGAGATTATGGAGGAGAGTAAGGCGGTGGGGGAGATGCTTCACGATGGAGCGGTGGGAGAC
GATGAGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail