Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05102
Gene name
Locationscaffold_05:2507477..2508386
Strand+
Gene length (bp)909
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 5.6E-23 27 203

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 64 82 18
3 97 119 22
4 185 207 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05102
MFAFGLTTLSQALLIPQQTSPGGPHRAISLLVLATTIFRAELAILLSATGLTLLLSNRIPPRQLITVVIGTLCAA
LVVSVPLDSYFWQKPVWPELWGFYFNAVLGSSSAWGVSPWHYYFTSAIPRTRHHASTLLVPSLSYIALYSLQPHK
ETRFIFYVVPPLTAAAALGADYVTSRRSKSKTYKVATLILISSVLATATASTAMLLVSSLNYPGGDALSHLQDLI
ARTTTTTTTTTTPDGTPPRRQSSPPTPTS*
Coding >Ophcf2|05102
ATGTTTGCCTTTGGCTTGACAACCCTATCCCAAGCCCTCCTCATCCCCCAGCAAACAAGCCCCGGAGGCCCCCAC
CGCGCAATATCCCTCCTCGTCCTAGCAACGACCATCTTCCGCGCCGAACTCGCCATCCTCCTCTCCGCCACAGGC
CTCACCCTCCTGCTATCAAACCGCATCCCCCCCCGCCAACTCATCACCGTGGTCATCGGCACGCTATGCGCCGCC
CTCGTCGTTTCCGTCCCGCTGGATTCCTACTTTTGGCAGAAACCCGTCTGGCCCGAGCTATGGGGCTTCTACTTC
AACGCCGTTCTCGGCTCGTCCTCTGCCTGGGGCGTCTCGCCCTGGCATTACTACTTCACCTCCGCCATCCCCCGC
ACACGCCACCACGCCTCGACCCTCCTCGTCCCAAGCCTCTCCTACATTGCCCTCTACTCCCTCCAACCACACAAA
GAAACCCGCTTCATCTTCTACGTCGTGCCCCCCCTGACCGCCGCCGCCGCCCTGGGCGCCGACTACGTCACCTCC
CGACGCAGCAAGTCCAAAACCTACAAAGTCGCAACCCTCATCCTCATATCCTCCGTCTTGGCAACCGCAACAGCA
AGCACGGCGATGCTCCTCGTCTCCTCCCTAAACTACCCAGGCGGAGATGCCCTATCGCACCTCCAAGACCTCATC
GCCCGCACCACAACAACAACAACAACAACAACAACCCCCGACGGAACCCCCCCCCGCCGACAATCATCACCGCCC
ACGCCGACGTCCTAA
Transcript >Ophcf2|05102
ATGTTTGCCTTTGGCTTGACAACCCTATCCCAAGCCCTCCTCATCCCCCAGCAAACAAGCCCCGGAGGCCCCCAC
CGCGCAATATCCCTCCTCGTCCTAGCAACGACCATCTTCCGCGCCGAACTCGCCATCCTCCTCTCCGCCACAGGC
CTCACCCTCCTGCTATCAAACCGCATCCCCCCCCGCCAACTCATCACCGTGGTCATCGGCACGCTATGCGCCGCC
CTCGTCGTTTCCGTCCCGCTGGATTCCTACTTTTGGCAGAAACCCGTCTGGCCCGAGCTATGGGGCTTCTACTTC
AACGCCGTTCTCGGCTCGTCCTCTGCCTGGGGCGTCTCGCCCTGGCATTACTACTTCACCTCCGCCATCCCCCGC
ACACGCCACCACGCCTCGACCCTCCTCGTCCCAAGCCTCTCCTACATTGCCCTCTACTCCCTCCAACCACACAAA
GAAACCCGCTTCATCTTCTACGTCGTGCCCCCCCTGACCGCCGCCGCCGCCCTGGGCGCCGACTACGTCACCTCC
CGACGCAGCAAGTCCAAAACCTACAAAGTCGCAACCCTCATCCTCATATCCTCCGTCTTGGCAACCGCAACAGCA
AGCACGGCGATGCTCCTCGTCTCCTCCCTAAACTACCCAGGCGGAGATGCCCTATCGCACCTCCAAGACCTCATC
GCCCGCACCACAACAACAACAACAACAACAACAACCCCCGACGGAACCCCCCCCCGCCGACAATCATCACCGCCC
ACGCCGACGTCCTAA
Gene >Ophcf2|05102
ATGTTTGCCTTTGGCTTGAGTACGTCCACTTCTCTGAAAAAAAAACAGGAAAAAACAAAGTTAATTAGCAACCTC
AACTGACAAACCCCCCCCTTCCCCCTCCCCAGCAACCCTATCCCAAGCCCTCCTCATCCCCCAGCAAACAAGCCC
CGGAGGCCCCCACCGCGCAATATCCCTCCTCGTCCTAGCAACGACCATCTTCCGCGCCGAACTCGCCATCCTCCT
CTCCGCCACAGGCCTCACCCTCCTGCTATCAAACCGCATCCCCCCCCGCCAACTCATCACCGTGGTCATCGGCAC
GCTATGCGCCGCCCTCGTCGTTTCCGTCCCGCTGGATTCCTACTTTTGGCAGAAACCCGTCTGGCCCGAGCTATG
GGGCTTCTACTTCAACGCCGTTCTCGGCTCGTCCTCTGCCTGGGGCGTCTCGCCCTGGCATTACTACTTCACCTC
CGCCATCCCCCGTCTCCTCCTCAACCCCTCTCCATCCCCCTCATCCTCCTCGCCCTCTACCAACCAGGCACACGC
CACCACGCCTCGACCCTCCTCGTCCCAAGCCTCTCCTACATTGCCCTCTACTCCCTCCAACCACACAAAGAAACC
CGCTTCATCTTCTACGTCGTGCCCCCCCTGACCGCCGCCGCCGCCCTGGGCGCCGACTACGTCACCTCCCGACGC
AGCAAGTCCAAAACCTACAAAGTCGCAACCCTCATCCTCATATCCTCCGTCTTGGCAACCGCAACAGCAAGCACG
GCGATGCTCCTCGTCTCCTCCCTAAACTACCCAGGCGGAGATGCCCTATCGCACCTCCAAGACCTCATCGCCCGC
ACCACAACAACAACAACAACAACAACAACCCCCGACGGAACCCCCCCCCGCCGACAATCATCACCGCCCACGCCG
ACGTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail