Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05098
Gene name
Locationscaffold_05:2499524..2500067
Strand-
Gene length (bp)543
Transcript length (bp)486
Coding sequence length (bp)486
Protein length (aa) 162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7723 0.4888 0.0211 0.2177 0.0477 0.0148 0.2002 0.2005 0.1398 0.0199

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5737
Ophiocordyceps australis map64 (Brazil) OphauB2|2241
Ophiocordyceps camponoti-floridani Ophcf2|05098 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3269
Ophiocordyceps kimflemingae Ophio5|3223
Ophiocordyceps subramaniannii Hirsu2|3586

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05098
MASASPEPAFVSAWSSRYRGATVQDLEPPAALSLNPSDAISVALISAFERDYTHLTIVDSKRRSLLGYISIPHLQ
SLLDAGRVRPEDPLSASMTRFQRKGKAYRIITMDTTLEDLECFFREGVSGGAWRQDFAVITDDRRRFVLGVATVQ
DLEEFVKRRPA*
Coding >Ophcf2|05098
ATGGCCTCAGCCTCGCCCGAACCGGCGTTTGTATCGGCTTGGTCATCGCGCTATCGCGGGGCTACCGTCCAGGAC
CTCGAGCCGCCAGCAGCCCTGTCCCTGAATCCCTCCGATGCCATTTCCGTAGCGCTCATCTCCGCCTTTGAGCGC
GACTACACGCATCTCACCATCGTCGACTCCAAGAGGCGCTCTCTCCTCGGCTACATCTCCATCCCCCATCTACAA
TCCCTCCTTGACGCCGGCCGCGTCCGGCCAGAGGATCCCCTCAGCGCCTCCATGACGCGCTTCCAGCGCAAGGGA
AAGGCCTACCGCATCATCACCATGGATACGACGCTTGAGGATCTGGAGTGCTTCTTTCGTGAGGGGGTCTCGGGC
GGGGCCTGGCGTCAGGACTTTGCCGTCATTACGGATGATAGGCGGCGCTTTGTCCTCGGCGTCGCTACCGTTCAG
GACTTGGAAGAGTTTGTGAAGAGGAGGCCTGCGTGA
Transcript >Ophcf2|05098
ATGGCCTCAGCCTCGCCCGAACCGGCGTTTGTATCGGCTTGGTCATCGCGCTATCGCGGGGCTACCGTCCAGGAC
CTCGAGCCGCCAGCAGCCCTGTCCCTGAATCCCTCCGATGCCATTTCCGTAGCGCTCATCTCCGCCTTTGAGCGC
GACTACACGCATCTCACCATCGTCGACTCCAAGAGGCGCTCTCTCCTCGGCTACATCTCCATCCCCCATCTACAA
TCCCTCCTTGACGCCGGCCGCGTCCGGCCAGAGGATCCCCTCAGCGCCTCCATGACGCGCTTCCAGCGCAAGGGA
AAGGCCTACCGCATCATCACCATGGATACGACGCTTGAGGATCTGGAGTGCTTCTTTCGTGAGGGGGTCTCGGGC
GGGGCCTGGCGTCAGGACTTTGCCGTCATTACGGATGATAGGCGGCGCTTTGTCCTCGGCGTCGCTACCGTTCAG
GACTTGGAAGAGTTTGTGAAGAGGAGGCCTGCGTGA
Gene >Ophcf2|05098
ATGGCCTCAGCCTCGCCCGAACCGGCGTTTGTATCGGCTTGGTCATCGCGCTATCGCGGGGTATCTTGGCATTTT
GACCTCGTCATCGTGGCCTCGACTGACTAGACTTTCCGCCAGGCTACCGTCCAGGACCTCGAGCCGCCAGCAGCC
CTGTCCCTGAATCCCTCCGATGCCATTTCCGTAGCGCTCATCTCCGCCTTTGAGCGCGACTACACGCATCTCACC
ATCGTCGACTCCAAGAGGCGCTCTCTCCTCGGCTACATCTCCATCCCCCATCTACAATCCCTCCTTGACGCCGGC
CGCGTCCGGCCAGAGGATCCCCTCAGCGCCTCCATGACGCGCTTCCAGCGCAAGGGAAAGGCCTACCGCATCATC
ACCATGGATACGACGCTTGAGGATCTGGAGTGCTTCTTTCGTGAGGGGGTCTCGGGCGGGGCCTGGCGTCAGGAC
TTTGCCGTCATTACGGATGATAGGCGGCGCTTTGTCCTCGGCGTCGCTACCGTTCAGGACTTGGAAGAGTTTGTG
AAGAGGAGGCCTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail