Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05088
Gene name
Locationscaffold_05:2468443..2469757
Strand-
Gene length (bp)1314
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02076 STE3 Pheromone A receptor 1.1E-64 40 331

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0004932 mating-type factor pheromone receptor activity Yes
GO:0016021 integral component of membrane Yes
GO:0060089 molecular transducer activity No
GO:0004930 G protein-coupled receptor activity No
GO:0050794 regulation of cellular process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0031224 intrinsic component of membrane No
GO:0008528 G protein-coupled peptide receptor activity No
GO:0038023 signaling receptor activity No
GO:0005575 cellular_component No
GO:0004888 transmembrane signaling receptor activity No
GO:0003674 molecular_function No
GO:0007165 signal transduction No
GO:0016503 pheromone receptor activity No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0001653 peptide receptor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 61 83 22
3 103 125 22
4 145 167 22
5 191 213 22
6 243 265 22
7 299 321 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05088
MDPSSEPGIHFLGGNQTAVVGPQPSAMASLTHNLILRVTLALAANAVCLVPLRVLRRNGEFAAAVCVISVELLNF
EAILCALIWRDDDVSSWWPGYGLCDIVIHLHNALTALFISCLLAIMRNLYQQVGLARAGPLHRSERRRRNLVQAL
IIFPLPLFNLALTLIIAERRYVIGTLMGCTWAPHSSWPNLAFFVFPPVVLSVITVVYAALTYFRFREIAKTTRTA
LSNNPRASRRSQRTKRRLYLMVTAIMVPTLPLVVAVAVANVLQKSGGEHFDFYAVHNQAEPPWSVILFYPSSEIL
WINLNNCYINVLVAIPIFGFFGTTKDAINEYRLVALANALLGNIDGVKPASSDCAKLLLFTVFKEASPPLSLSVR
LFLS*
Coding >Ophcf2|05088
ATGGATCCCTCGTCGGAGCCGGGGATTCACTTCCTGGGAGGAAATCAGACCGCCGTCGTCGGCCCACAGCCGTCC
GCAATGGCCTCTCTCACTCACAATCTGATTCTGCGCGTGACGCTGGCGCTGGCCGCCAACGCCGTGTGTCTGGTG
CCGCTGCGAGTTCTCCGTCGAAACGGCGAGTTTGCTGCGGCCGTCTGCGTCATCTCGGTTGAACTTCTCAATTTC
GAAGCCATTCTCTGCGCGCTCATCTGGCGTGACGATGACGTTTCTTCTTGGTGGCCTGGCTATGGCCTCTGCGAC
ATCGTCATCCACTTGCACAACGCTCTTACGGCCCTCTTCATCAGCTGCCTCCTCGCCATCATGCGGAATCTTTAC
CAGCAGGTCGGCCTCGCGCGTGCCGGGCCTCTTCATCGCAGCGAGAGACGGCGCCGCAACCTAGTCCAGGCCCTC
ATCATCTTTCCCCTGCCCCTATTCAATCTGGCCCTGACGTTGATTATCGCCGAACGACGCTATGTGATTGGCACT
CTCATGGGCTGTACCTGGGCACCGCACTCGTCCTGGCCCAATTTGGCCTTTTTTGTGTTTCCCCCGGTCGTTCTA
TCCGTCATTACCGTTGTCTACGCGGCTCTAACGTACTTTCGCTTCCGCGAAATCGCCAAGACGACCCGAACGGCA
CTTTCCAACAACCCCAGAGCGAGTCGACGCAGCCAGCGAACCAAACGCAGACTTTACCTGATGGTCACGGCCATC
ATGGTGCCTACGTTGCCCCTGGTTGTTGCTGTTGCCGTCGCAAACGTGTTGCAAAAGTCCGGCGGAGAACACTTC
GACTTTTACGCCGTCCATAACCAGGCTGAGCCGCCCTGGTCCGTCATTCTCTTCTATCCGTCGTCGGAGATTCTG
TGGATCAATTTGAACAACTGCTACATCAATGTTCTCGTCGCCATTCCCATCTTTGGGTTTTTTGGCACCACCAAG
GACGCTATTAACGAGTACCGACTCGTTGCGTTGGCGAATGCCTTGCTCGGGAACATCGACGGGGTCAAGCCAGCC
AGCTCTGACTGTGCAAAGCTTCTCCTCTTCACCGTTTTCAAAGAAGCCTCGCCGCCTCTCTCTCTTTCGGTCCGT
CTCTTCCTCTCGTAA
Transcript >Ophcf2|05088
ATGGATCCCTCGTCGGAGCCGGGGATTCACTTCCTGGGAGGAAATCAGACCGCCGTCGTCGGCCCACAGCCGTCC
GCAATGGCCTCTCTCACTCACAATCTGATTCTGCGCGTGACGCTGGCGCTGGCCGCCAACGCCGTGTGTCTGGTG
CCGCTGCGAGTTCTCCGTCGAAACGGCGAGTTTGCTGCGGCCGTCTGCGTCATCTCGGTTGAACTTCTCAATTTC
GAAGCCATTCTCTGCGCGCTCATCTGGCGTGACGATGACGTTTCTTCTTGGTGGCCTGGCTATGGCCTCTGCGAC
ATCGTCATCCACTTGCACAACGCTCTTACGGCCCTCTTCATCAGCTGCCTCCTCGCCATCATGCGGAATCTTTAC
CAGCAGGTCGGCCTCGCGCGTGCCGGGCCTCTTCATCGCAGCGAGAGACGGCGCCGCAACCTAGTCCAGGCCCTC
ATCATCTTTCCCCTGCCCCTATTCAATCTGGCCCTGACGTTGATTATCGCCGAACGACGCTATGTGATTGGCACT
CTCATGGGCTGTACCTGGGCACCGCACTCGTCCTGGCCCAATTTGGCCTTTTTTGTGTTTCCCCCGGTCGTTCTA
TCCGTCATTACCGTTGTCTACGCGGCTCTAACGTACTTTCGCTTCCGCGAAATCGCCAAGACGACCCGAACGGCA
CTTTCCAACAACCCCAGAGCGAGTCGACGCAGCCAGCGAACCAAACGCAGACTTTACCTGATGGTCACGGCCATC
ATGGTGCCTACGTTGCCCCTGGTTGTTGCTGTTGCCGTCGCAAACGTGTTGCAAAAGTCCGGCGGAGAACACTTC
GACTTTTACGCCGTCCATAACCAGGCTGAGCCGCCCTGGTCCGTCATTCTCTTCTATCCGTCGTCGGAGATTCTG
TGGATCAATTTGAACAACTGCTACATCAATGTTCTCGTCGCCATTCCCATCTTTGGGTTTTTTGGCACCACCAAG
GACGCTATTAACGAGTACCGACTCGTTGCGTTGGCGAATGCCTTGCTCGGGAACATCGACGGGGTCAAGCCAGCC
AGCTCTGACTGTGCAAAGCTTCTCCTCTTCACCGTTTTCAAAGAAGCCTCGCCGCCTCTCTCTCTTTCGGTCCGT
CTCTTCCTCTCGTAA
Gene >Ophcf2|05088
ATGGATCCCTCGTCGGAGCCGGGGATTCACTTCCTGGGAGGAAATCAGACCGCCGTCGTCGGCCCACAGCCGTCC
GCAATGGCCTCTCTCACTCACAATCTGATTCTGCGCGTGACGCTGGCGCTGGCCGCCAACGCCGTGTGTCTGGTG
CCGCTGCGAGTTCTCCGTCGAAACGGCGAGTTTGCTGCGGCCGTCTGCGTCATCTCGGTTGAACTTCTCAATTTC
GAAGCCATTCTCTGCGCGCTCATCTGGCGTGACGATGACGTTTCTTCTTGGTGGCCTGGCTATGGCCTCTGCGAC
ATCGTCATCCACTTGCACAACGCTCTTACGGCCCTCTTCATCAGCTGCCTCCTCGCCATCATGCGGAATCTTTAC
CAGCAGGTCGGCCTCGCGCGTGCCGGGCCTCTTCATCGCAGCGAGAGACGGCGCCGCAACCTAGTCCAGGCCCTC
ATCATCTTTCCCCTGCCCCTATTCAATCTGGCCCTGACGTTGATTATCGCCGAACGACGCTATGTGATTGGCACT
CTCATGGGCTGTACCTGGGCACCGCACTCGTCCTGGCCCAATTTGGCCTTTTTTGTGTTTCCCCCGGTCGTTCTA
TCCGTCATTACCGTTGTCTACGCGGGTAAGTCTGAATCATATGAGCATGAAGAGAGCTTTGGACTGATCAACGGG
AATATCAATAGCTCTAACGTACTTTCGCTTCCGCGAAATCGCCAAGACGACCCGAACGGCACTTTCCAACAACCC
CAGAGCGAGTCGACGCAGCCAGCGAACCAAACGCAGACTTTACCTGATGGTCACGGCCATCATGGTGCCTACGTT
GCCCCTGGTTGTTGCTGTTGCCGTCGCAAACGTGTTGCAAAAGTCCGGCGGAGAACACTTCGACTTTTACGCCGT
CCATAACCAGGCTGAGCCGCCCTGGTCCGTCATTCTCTTCTATCCGTCGTCGGAGATTCTGTGGATCAATTTGAA
CAACTGCTACATCAATGTTCTCGTCGCCATTCCCATCTTTGGGTTTTTTGGCACCACCAAGGACGCTATTAACGA
GTACCGACTCGTTGCGTTGGCGGTTGGCCTCGGCTACCTTTTCCCTGCTCTTCGACGAGAGTACGATCCGGACAG
AATGCCTTGCTCGGGAACATCGACGGGGTCAAGCCAGCCAGCTCTGACTGTGCAAAGGTAAGACGACTTTGATAC
TCGTCCCTGCTTTGTAACGGCGCTGACATTGATCTCTCTCAGCTTCTCCTCTTCACCGTTTTCAAAGAAGCCTCG
CCGCCTCTCTCTCTTTCGGTCCGTCTCTTCCTCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail