Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05084
Gene name
Locationscaffold_05:2455839..2458411
Strand-
Gene length (bp)2572
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 427 446 19
2 459 481 22
3 491 513 22
4 590 612 22
5 617 634 17
6 681 703 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 32.41 18.49 46.32
Alive In ants, during behavior modification 43.25 24.46 62.05
Dead In ants, recently dead 43.80 25.17 62.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.127058 no
Alive Dead 0.952607 no
Dead Fungus 0.104189 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05084
MPFGQHPVAGLVLLLLFLWMLFPESEYQSLAQSELAASRLARYREALDTLGASSWGDFSPDELHEATADSNDAAP
DITSDAVPDAVPDAAANATSHFINLTGFRQVDGFAWEDLASFREKALRLSHHAMPLVAGRQLWDVAQGEAVWANA
SGTLRGDWVRRPGSVSRRYDNYNLSLSVPDMAWAGEHAEWARNMTGDAGRMTLRLEANRTVTKYDDMAPGTSPLS
GGVIRDVRGTVTVEDTNGSGHNWEMRLWGVHWPRQGVILMTTTSEKFEGIFGLPHLAPGPDFFLSSQTLLNSTLN
SVITRKQHNINLDPNMPWNSDVDNMQYTAYPSPHCEFIMYAQVYPPIERASPAAGGTDGSEGIIRAIEAELENPL
GAPIGSVPRLKLSAVIYSPDCAFFLESKGPPDFPPTDSSHLVGMKTEVHLRQVQRWIIAFALVVFFQVYLFKNQM
KETFTPSTMGRISFWTLSAMAVVDCMTFIAALTWMSSAGATFLPTLTLAFASFSSTLMAGCLLSKVHEVQLPEGR
LRREAGPGDGGAAPTATPPRPVPPASEPAPATSLLGLVTLPSDQDIGAEMAMTRLPSPQSFQNRLGRLLLFTLCV
TLVAVSSSTWHPLARSFFLNLCAFAYLSMWVPQIYRNTMRNCRRAMRWPFVAGQTTLRLLPVAYFWVKEDNFLYA
RADKAAFCVLLAWIWLQLAILAVQEVMGPRFCIPASWTPDGWDYHPVLGEDAVEAGCLPIGLVTDDSRRRGSNAS
LKRGNVRAIDCAICHEALEVPVLKAGDDDDGSVASVFARRLVPSAGRICRRYDGKSLNGASLAGD*
Coding >Ophcf2|05084
ATGCCTTTCGGTCAGCATCCCGTCGCCGGTCTCGTCCTGCTGCTTCTCTTCTTGTGGATGCTCTTCCCGGAGAGC
GAGTATCAGTCACTCGCCCAGTCCGAGCTCGCCGCCAGCCGGCTCGCGCGCTACCGCGAGGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTTCGCCCGATGAGCTCCATGAAGCCACTGCAGATTCGAACGATGCCGCACCA
GATATCACTTCCGATGCCGTCCCCGACGCCGTCCCCGACGCCGCTGCCAACGCCACCTCCCACTTTATCAACCTC
ACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGC
CATCACGCCATGCCTCTGGTGGCCGGCCGTCAGCTTTGGGACGTGGCACAGGGCGAGGCTGTCTGGGCCAACGCA
TCCGGCACCCTCCGCGGCGACTGGGTTCGCCGTCCCGGCTCCGTCTCACGCCGCTACGACAATTACAACTTGAGC
CTCAGTGTTCCGGACATGGCATGGGCTGGCGAACACGCTGAATGGGCGCGCAATATGACGGGAGACGCCGGTCGT
ATGACGCTCCGCCTCGAAGCGAACCGTACCGTGACCAAATATGACGACATGGCCCCCGGCACAAGCCCTCTCTCC
GGCGGCGTCATCCGCGATGTTAGGGGCACTGTTACAGTCGAGGACACGAACGGCTCCGGTCACAACTGGGAGATG
CGCCTCTGGGGGGTCCATTGGCCGCGTCAGGGCGTTATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGCATC
TTTGGCCTGCCACACCTAGCTCCAGGTCCCGATTTCTTCCTTTCGAGTCAGACGTTACTCAACAGCACGCTCAAC
AGCGTCATCACCAGGAAGCAACACAACATCAACCTCGACCCTAACATGCCTTGGAACTCGGACGTCGACAACATG
CAATACACGGCCTATCCCTCGCCACACTGTGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAGCGCGCT
TCACCGGCAGCTGGCGGGACCGACGGCTCCGAAGGCATCATCCGCGCCATCGAGGCGGAGCTCGAGAACCCCCTG
GGCGCACCCATCGGCTCCGTTCCGCGACTCAAGCTGTCGGCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTC
GAGTCCAAGGGTCCGCCTGACTTTCCGCCGACGGACAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTC
CGTCAGGTTCAAAGGTGGATCATCGCCTTCGCCCTCGTCGTCTTCTTTCAAGTATATCTATTCAAGAATCAGATG
AAGGAGACGTTTACGCCTTCGACAATGGGTCGCATCAGCTTCTGGACCTTGAGCGCCATGGCCGTCGTCGACTGC
ATGACGTTTATCGCCGCCCTGACGTGGATGTCATCGGCGGGCGCTACCTTTTTGCCGACGCTGACTCTCGCGTTT
GCATCGTTCTCGTCGACGCTCATGGCCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAAGGACGC
CTTCGACGGGAGGCCGGTCCGGGCGACGGCGGTGCGGCCCCGACGGCGACTCCGCCGAGACCAGTGCCACCGGCG
TCCGAACCGGCGCCCGCGACGTCGCTCTTGGGGCTCGTAACGCTGCCGTCGGACCAGGATATCGGCGCTGAGATG
GCGATGACGCGGTTGCCGTCGCCGCAGTCGTTCCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTATGCGTC
ACCTTGGTGGCCGTGTCGTCATCGACGTGGCATCCCCTTGCGCGTTCTTTCTTCCTTAACCTGTGTGCCTTTGCC
TACCTGTCGATGTGGGTGCCGCAGATCTATCGCAACACGATGCGAAACTGCAGACGGGCAATGAGGTGGCCGTTC
GTGGCCGGACAAACAACACTGCGGCTGCTGCCGGTGGCCTACTTCTGGGTAAAGGAGGACAACTTCCTGTACGCG
CGGGCGGACAAAGCGGCCTTTTGCGTTCTCTTGGCCTGGATCTGGCTGCAGTTGGCGATATTGGCGGTGCAGGAG
GTTATGGGTCCACGCTTCTGCATACCGGCCAGCTGGACGCCCGACGGTTGGGATTATCACCCCGTTCTGGGCGAG
GACGCGGTCGAGGCGGGCTGCCTGCCGATCGGACTGGTGACGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCA
CTTAAGCGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTTCCGGTACTCAAGGCC
GGCGACGACGACGACGGCAGCGTGGCGAGCGTCTTTGCGAGGAGACTTGTCCCATCTGCCGGGAGGATCTGCCGC
CGATATGATGGGAAGTCTCTGAACGGGGCGTCTCTTGCAGGTGACTGA
Transcript >Ophcf2|05084
ATGCCTTTCGGTCAGCATCCCGTCGCCGGTCTCGTCCTGCTGCTTCTCTTCTTGTGGATGCTCTTCCCGGAGAGC
GAGTATCAGTCACTCGCCCAGTCCGAGCTCGCCGCCAGCCGGCTCGCGCGCTACCGCGAGGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTTCGCCCGATGAGCTCCATGAAGCCACTGCAGATTCGAACGATGCCGCACCA
GATATCACTTCCGATGCCGTCCCCGACGCCGTCCCCGACGCCGCTGCCAACGCCACCTCCCACTTTATCAACCTC
ACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGC
CATCACGCCATGCCTCTGGTGGCCGGCCGTCAGCTTTGGGACGTGGCACAGGGCGAGGCTGTCTGGGCCAACGCA
TCCGGCACCCTCCGCGGCGACTGGGTTCGCCGTCCCGGCTCCGTCTCACGCCGCTACGACAATTACAACTTGAGC
CTCAGTGTTCCGGACATGGCATGGGCTGGCGAACACGCTGAATGGGCGCGCAATATGACGGGAGACGCCGGTCGT
ATGACGCTCCGCCTCGAAGCGAACCGTACCGTGACCAAATATGACGACATGGCCCCCGGCACAAGCCCTCTCTCC
GGCGGCGTCATCCGCGATGTTAGGGGCACTGTTACAGTCGAGGACACGAACGGCTCCGGTCACAACTGGGAGATG
CGCCTCTGGGGGGTCCATTGGCCGCGTCAGGGCGTTATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGCATC
TTTGGCCTGCCACACCTAGCTCCAGGTCCCGATTTCTTCCTTTCGAGTCAGACGTTACTCAACAGCACGCTCAAC
AGCGTCATCACCAGGAAGCAACACAACATCAACCTCGACCCTAACATGCCTTGGAACTCGGACGTCGACAACATG
CAATACACGGCCTATCCCTCGCCACACTGTGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAGCGCGCT
TCACCGGCAGCTGGCGGGACCGACGGCTCCGAAGGCATCATCCGCGCCATCGAGGCGGAGCTCGAGAACCCCCTG
GGCGCACCCATCGGCTCCGTTCCGCGACTCAAGCTGTCGGCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTC
GAGTCCAAGGGTCCGCCTGACTTTCCGCCGACGGACAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTC
CGTCAGGTTCAAAGGTGGATCATCGCCTTCGCCCTCGTCGTCTTCTTTCAAGTATATCTATTCAAGAATCAGATG
AAGGAGACGTTTACGCCTTCGACAATGGGTCGCATCAGCTTCTGGACCTTGAGCGCCATGGCCGTCGTCGACTGC
ATGACGTTTATCGCCGCCCTGACGTGGATGTCATCGGCGGGCGCTACCTTTTTGCCGACGCTGACTCTCGCGTTT
GCATCGTTCTCGTCGACGCTCATGGCCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAAGGACGC
CTTCGACGGGAGGCCGGTCCGGGCGACGGCGGTGCGGCCCCGACGGCGACTCCGCCGAGACCAGTGCCACCGGCG
TCCGAACCGGCGCCCGCGACGTCGCTCTTGGGGCTCGTAACGCTGCCGTCGGACCAGGATATCGGCGCTGAGATG
GCGATGACGCGGTTGCCGTCGCCGCAGTCGTTCCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTATGCGTC
ACCTTGGTGGCCGTGTCGTCATCGACGTGGCATCCCCTTGCGCGTTCTTTCTTCCTTAACCTGTGTGCCTTTGCC
TACCTGTCGATGTGGGTGCCGCAGATCTATCGCAACACGATGCGAAACTGCAGACGGGCAATGAGGTGGCCGTTC
GTGGCCGGACAAACAACACTGCGGCTGCTGCCGGTGGCCTACTTCTGGGTAAAGGAGGACAACTTCCTGTACGCG
CGGGCGGACAAAGCGGCCTTTTGCGTTCTCTTGGCCTGGATCTGGCTGCAGTTGGCGATATTGGCGGTGCAGGAG
GTTATGGGTCCACGCTTCTGCATACCGGCCAGCTGGACGCCCGACGGTTGGGATTATCACCCCGTTCTGGGCGAG
GACGCGGTCGAGGCGGGCTGCCTGCCGATCGGACTGGTGACGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCA
CTTAAGCGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTTCCGGTACTCAAGGCC
GGCGACGACGACGACGGCAGCGTGGCGAGCGTCTTTGCGAGGAGACTTGTCCCATCTGCCGGGAGGATCTGCCGC
CGATATGATGGGAAGTCTCTGAACGGGGCGTCTCTTGCAGGTGACTGA
Gene >Ophcf2|05084
ATGCCTTTCGGTCAGCATCCCGTCGCCGGTCTCGTCCTGCTGCTTCTCTTCTTGTGGATGCTCTTCCCGGAGAGC
GAGTATCAGTCACTCGCCCAGTCCGAGCTCGCCGCCAGCCGGCTCGCGCGCTACCGCGAGGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTTCGCCCGATGAGCTCCATGAAGCCACTGCAGATTCGAACGATGCCGCACCA
GATATCACTTCCGATGCCGTCCCCGACGCCGTCCCCGACGCCGCTGCCAACGCCACCTCCCACTTTATCAACCTC
ACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGC
CATCACGCCATGCCTCTGGTGGCCGGCCGTCAGCTTTGGGACGTGGCACAGGGCGAGGCTGTCTGGGCCAACGCA
TCCGGCACCCTCCGCGGCGACTGGGTTCGCCGTCCCGGCTCCGTCTCACGCCGCTACGACAATTACAACTTGAGC
CTCAGTGTTCCGGACATGGCATGGGCTGGCGAACACGCTGAATGGGCGCGCAATATGACGGGAGACGCCGGTCGT
ATGACGCTCCGCCTCGAAGCGAACCGTACCGTGACCAAATATGACGACATGGCCCCCGGCACAAGCCCTCTCTCC
GGCGGCGTCATCCGCGATGTTAGGGGCACTGTTACAGTCGAGGACACGAACGGCTCCGGTCACAACTGGGAGATG
CGCCTCTGGGGGGTCCATTGGCCGCGTCAGGGCGTTATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGCATC
TTTGGCCTGCCACACCTAGCTCCAGGTCCCGATTTCTTCCTTTCGAGTCAGACGTTACTCAACAGCACGCTCAAC
AGCGTCATCACCAGGAAGCAACACAACATCAACCTCGACCCTAACATGCCTTGGAACTCGGACGTCGACAACATG
CAATACACGGCCTATCCCTCGCCACACTGTGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAGCGCGCT
TCACCGGCAGCTGGCGGGACCGACGGCTCCGAAGGCATCATCCGCGCCATCGAGGCGGAGCTCGAGAACCCCCTG
GGCGCACCCATCGGCTCCGTTCCGCGACTCAAGCTGTCGGCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTC
GAGTCCAAGGGTCCGCCTGACTTTCCGCCGACGGACAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTC
CGTCAGGTTCAAAGGTGGATCATCGCCTTCGCCCTCGTCGTCTTCTTTCAAGTATATCTATTCAAGAATCAGATG
AAGGAGACGTTTACGCCTTCGACAATGGGTCGCATCAGCTTCTGGACCTTGAGCGCCATGGCCGTCGTCGACTGC
ATGACGTTTATCGCCGCCCTGACGTGGATGTCATCGGCGGGCGCTACCTTTTTGCCGACGCTGACTCTCGCGTTT
GCATCGTTCTCGTCGACGCTCATGGCCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAAGGACGC
CTTCGACGGGAGGCCGGTCCGGGCGACGGCGGTGCGGCCCCGACGGCGACTCCGCCGAGACCAGTGCCACCGGCG
TCCGAACCGGCGCCCGCGACGTCGCTCTTGGGGCTCGTAACGCTGCCGTCGGACCAGGATATCGGCGCTGAGATG
GCGATGACGCGGTTGCCGTCGCCGCAGTCGTTCCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTATGCGTC
ACCTTGGTGGCCGTGTCGTCATCGACGTGGCATCCCCTTGCGCGTTCTTTCTTCCTTAACCTGTGTGCCTTTGCC
TACCTGTCGATGTGGGTGCCGCAGATCTATCGCAACACGATGCGAAACTGCAGACGGGCAATGAGGTGGCCGTTC
GTGGCCGGACAAACAACACTGCGGCTGCTGCCGGTGGCCTACTTCTGGGTAAAGGAGGACAACTTCCTGTACGCG
CGGGCGGACAAAGCGGCCTTTTGCGTTCTCTTGGCCTGGATCTGGCTGCAGTTGGCGATATTGGCGGTGCAGGAG
GTTATGGGTCCACGCTTCTGCATACCGGCCAGCTGGACGCCCGACGGTTGGGATTATCACCCCGTTCTGGGCGAG
GACGCGGTCGAGGCGGGCTGCCTGCCGATCGGACTGGTGACGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCA
CTTAAGCGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTTCCGGTACTCAAGGCC
GGCGACGACGACGACGGCAGCGTGGCGAGCGTCTTTGCGAGGAGACTGTACATGATGACGCCTTGCCGGCACATC
TTCCACACGCACTGCTTGGAAGGCTGGATGAGAGTCCGGCTGCAGTGTCCCATCTGCCGGGAGGATCTGCCGCCG
ATATGATGGGAAGTCTCTGAACGGGGCGTCTCTTGGTGGGTTCTTGCAAAGCAGCGATCTGTGCCGCTCTACTCA
CCTCCCTATAGCAGGTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail