Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05084
Gene name
Locationscaffold_05:2455839..2458411
Strand-
Gene length (bp)2572
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain 0.2008 0.2011 0.0209 0.0962 0.2373 0.0365 0.8009 0.6342 0.7964 0.0324

SignalP

SignalP signal predicted Location Score
Yes 1 - 29 0.735694

Transmembrane Domains

Domain # Start End Length
1 427 446 19
2 459 481 22
3 491 513 22
4 590 612 22
5 617 634 17
6 681 703 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1621
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7149
Ophiocordyceps australis map64 (Brazil) OphauB2|3605
Ophiocordyceps camponoti-floridani Ophcf2|05084 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2858
Ophiocordyceps kimflemingae Ophio5|5201
Ophiocordyceps subramaniannii Hirsu2|1286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05084
MPFGQHPVAGLVLLLLFLWMLFPESEYQSLAQSELAASRLARYREALDTLGASSWGDFSPDELHEATADSNDAAP
DITSDAVPDAVPDAAANATSHFINLTGFRQVDGFAWEDLASFREKALRLSHHAMPLVAGRQLWDVAQGEAVWANA
SGTLRGDWVRRPGSVSRRYDNYNLSLSVPDMAWAGEHAEWARNMTGDAGRMTLRLEANRTVTKYDDMAPGTSPLS
GGVIRDVRGTVTVEDTNGSGHNWEMRLWGVHWPRQGVILMTTTSEKFEGIFGLPHLAPGPDFFLSSQTLLNSTLN
SVITRKQHNINLDPNMPWNSDVDNMQYTAYPSPHCEFIMYAQVYPPIERASPAAGGTDGSEGIIRAIEAELENPL
GAPIGSVPRLKLSAVIYSPDCAFFLESKGPPDFPPTDSSHLVGMKTEVHLRQVQRWIIAFALVVFFQVYLFKNQM
KETFTPSTMGRISFWTLSAMAVVDCMTFIAALTWMSSAGATFLPTLTLAFASFSSTLMAGCLLSKVHEVQLPEGR
LRREAGPGDGGAAPTATPPRPVPPASEPAPATSLLGLVTLPSDQDIGAEMAMTRLPSPQSFQNRLGRLLLFTLCV
TLVAVSSSTWHPLARSFFLNLCAFAYLSMWVPQIYRNTMRNCRRAMRWPFVAGQTTLRLLPVAYFWVKEDNFLYA
RADKAAFCVLLAWIWLQLAILAVQEVMGPRFCIPASWTPDGWDYHPVLGEDAVEAGCLPIGLVTDDSRRRGSNAS
LKRGNVRAIDCAICHEALEVPVLKAGDDDDGSVASVFARRLVPSAGRICRRYDGKSLNGASLAGD*
Coding >Ophcf2|05084
ATGCCTTTCGGTCAGCATCCCGTCGCCGGTCTCGTCCTGCTGCTTCTCTTCTTGTGGATGCTCTTCCCGGAGAGC
GAGTATCAGTCACTCGCCCAGTCCGAGCTCGCCGCCAGCCGGCTCGCGCGCTACCGCGAGGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTTCGCCCGATGAGCTCCATGAAGCCACTGCAGATTCGAACGATGCCGCACCA
GATATCACTTCCGATGCCGTCCCCGACGCCGTCCCCGACGCCGCTGCCAACGCCACCTCCCACTTTATCAACCTC
ACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGC
CATCACGCCATGCCTCTGGTGGCCGGCCGTCAGCTTTGGGACGTGGCACAGGGCGAGGCTGTCTGGGCCAACGCA
TCCGGCACCCTCCGCGGCGACTGGGTTCGCCGTCCCGGCTCCGTCTCACGCCGCTACGACAATTACAACTTGAGC
CTCAGTGTTCCGGACATGGCATGGGCTGGCGAACACGCTGAATGGGCGCGCAATATGACGGGAGACGCCGGTCGT
ATGACGCTCCGCCTCGAAGCGAACCGTACCGTGACCAAATATGACGACATGGCCCCCGGCACAAGCCCTCTCTCC
GGCGGCGTCATCCGCGATGTTAGGGGCACTGTTACAGTCGAGGACACGAACGGCTCCGGTCACAACTGGGAGATG
CGCCTCTGGGGGGTCCATTGGCCGCGTCAGGGCGTTATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGCATC
TTTGGCCTGCCACACCTAGCTCCAGGTCCCGATTTCTTCCTTTCGAGTCAGACGTTACTCAACAGCACGCTCAAC
AGCGTCATCACCAGGAAGCAACACAACATCAACCTCGACCCTAACATGCCTTGGAACTCGGACGTCGACAACATG
CAATACACGGCCTATCCCTCGCCACACTGTGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAGCGCGCT
TCACCGGCAGCTGGCGGGACCGACGGCTCCGAAGGCATCATCCGCGCCATCGAGGCGGAGCTCGAGAACCCCCTG
GGCGCACCCATCGGCTCCGTTCCGCGACTCAAGCTGTCGGCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTC
GAGTCCAAGGGTCCGCCTGACTTTCCGCCGACGGACAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTC
CGTCAGGTTCAAAGGTGGATCATCGCCTTCGCCCTCGTCGTCTTCTTTCAAGTATATCTATTCAAGAATCAGATG
AAGGAGACGTTTACGCCTTCGACAATGGGTCGCATCAGCTTCTGGACCTTGAGCGCCATGGCCGTCGTCGACTGC
ATGACGTTTATCGCCGCCCTGACGTGGATGTCATCGGCGGGCGCTACCTTTTTGCCGACGCTGACTCTCGCGTTT
GCATCGTTCTCGTCGACGCTCATGGCCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAAGGACGC
CTTCGACGGGAGGCCGGTCCGGGCGACGGCGGTGCGGCCCCGACGGCGACTCCGCCGAGACCAGTGCCACCGGCG
TCCGAACCGGCGCCCGCGACGTCGCTCTTGGGGCTCGTAACGCTGCCGTCGGACCAGGATATCGGCGCTGAGATG
GCGATGACGCGGTTGCCGTCGCCGCAGTCGTTCCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTATGCGTC
ACCTTGGTGGCCGTGTCGTCATCGACGTGGCATCCCCTTGCGCGTTCTTTCTTCCTTAACCTGTGTGCCTTTGCC
TACCTGTCGATGTGGGTGCCGCAGATCTATCGCAACACGATGCGAAACTGCAGACGGGCAATGAGGTGGCCGTTC
GTGGCCGGACAAACAACACTGCGGCTGCTGCCGGTGGCCTACTTCTGGGTAAAGGAGGACAACTTCCTGTACGCG
CGGGCGGACAAAGCGGCCTTTTGCGTTCTCTTGGCCTGGATCTGGCTGCAGTTGGCGATATTGGCGGTGCAGGAG
GTTATGGGTCCACGCTTCTGCATACCGGCCAGCTGGACGCCCGACGGTTGGGATTATCACCCCGTTCTGGGCGAG
GACGCGGTCGAGGCGGGCTGCCTGCCGATCGGACTGGTGACGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCA
CTTAAGCGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTTCCGGTACTCAAGGCC
GGCGACGACGACGACGGCAGCGTGGCGAGCGTCTTTGCGAGGAGACTTGTCCCATCTGCCGGGAGGATCTGCCGC
CGATATGATGGGAAGTCTCTGAACGGGGCGTCTCTTGCAGGTGACTGA
Transcript >Ophcf2|05084
ATGCCTTTCGGTCAGCATCCCGTCGCCGGTCTCGTCCTGCTGCTTCTCTTCTTGTGGATGCTCTTCCCGGAGAGC
GAGTATCAGTCACTCGCCCAGTCCGAGCTCGCCGCCAGCCGGCTCGCGCGCTACCGCGAGGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTTCGCCCGATGAGCTCCATGAAGCCACTGCAGATTCGAACGATGCCGCACCA
GATATCACTTCCGATGCCGTCCCCGACGCCGTCCCCGACGCCGCTGCCAACGCCACCTCCCACTTTATCAACCTC
ACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGC
CATCACGCCATGCCTCTGGTGGCCGGCCGTCAGCTTTGGGACGTGGCACAGGGCGAGGCTGTCTGGGCCAACGCA
TCCGGCACCCTCCGCGGCGACTGGGTTCGCCGTCCCGGCTCCGTCTCACGCCGCTACGACAATTACAACTTGAGC
CTCAGTGTTCCGGACATGGCATGGGCTGGCGAACACGCTGAATGGGCGCGCAATATGACGGGAGACGCCGGTCGT
ATGACGCTCCGCCTCGAAGCGAACCGTACCGTGACCAAATATGACGACATGGCCCCCGGCACAAGCCCTCTCTCC
GGCGGCGTCATCCGCGATGTTAGGGGCACTGTTACAGTCGAGGACACGAACGGCTCCGGTCACAACTGGGAGATG
CGCCTCTGGGGGGTCCATTGGCCGCGTCAGGGCGTTATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGCATC
TTTGGCCTGCCACACCTAGCTCCAGGTCCCGATTTCTTCCTTTCGAGTCAGACGTTACTCAACAGCACGCTCAAC
AGCGTCATCACCAGGAAGCAACACAACATCAACCTCGACCCTAACATGCCTTGGAACTCGGACGTCGACAACATG
CAATACACGGCCTATCCCTCGCCACACTGTGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAGCGCGCT
TCACCGGCAGCTGGCGGGACCGACGGCTCCGAAGGCATCATCCGCGCCATCGAGGCGGAGCTCGAGAACCCCCTG
GGCGCACCCATCGGCTCCGTTCCGCGACTCAAGCTGTCGGCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTC
GAGTCCAAGGGTCCGCCTGACTTTCCGCCGACGGACAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTC
CGTCAGGTTCAAAGGTGGATCATCGCCTTCGCCCTCGTCGTCTTCTTTCAAGTATATCTATTCAAGAATCAGATG
AAGGAGACGTTTACGCCTTCGACAATGGGTCGCATCAGCTTCTGGACCTTGAGCGCCATGGCCGTCGTCGACTGC
ATGACGTTTATCGCCGCCCTGACGTGGATGTCATCGGCGGGCGCTACCTTTTTGCCGACGCTGACTCTCGCGTTT
GCATCGTTCTCGTCGACGCTCATGGCCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAAGGACGC
CTTCGACGGGAGGCCGGTCCGGGCGACGGCGGTGCGGCCCCGACGGCGACTCCGCCGAGACCAGTGCCACCGGCG
TCCGAACCGGCGCCCGCGACGTCGCTCTTGGGGCTCGTAACGCTGCCGTCGGACCAGGATATCGGCGCTGAGATG
GCGATGACGCGGTTGCCGTCGCCGCAGTCGTTCCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTATGCGTC
ACCTTGGTGGCCGTGTCGTCATCGACGTGGCATCCCCTTGCGCGTTCTTTCTTCCTTAACCTGTGTGCCTTTGCC
TACCTGTCGATGTGGGTGCCGCAGATCTATCGCAACACGATGCGAAACTGCAGACGGGCAATGAGGTGGCCGTTC
GTGGCCGGACAAACAACACTGCGGCTGCTGCCGGTGGCCTACTTCTGGGTAAAGGAGGACAACTTCCTGTACGCG
CGGGCGGACAAAGCGGCCTTTTGCGTTCTCTTGGCCTGGATCTGGCTGCAGTTGGCGATATTGGCGGTGCAGGAG
GTTATGGGTCCACGCTTCTGCATACCGGCCAGCTGGACGCCCGACGGTTGGGATTATCACCCCGTTCTGGGCGAG
GACGCGGTCGAGGCGGGCTGCCTGCCGATCGGACTGGTGACGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCA
CTTAAGCGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTTCCGGTACTCAAGGCC
GGCGACGACGACGACGGCAGCGTGGCGAGCGTCTTTGCGAGGAGACTTGTCCCATCTGCCGGGAGGATCTGCCGC
CGATATGATGGGAAGTCTCTGAACGGGGCGTCTCTTGCAGGTGACTGA
Gene >Ophcf2|05084
ATGCCTTTCGGTCAGCATCCCGTCGCCGGTCTCGTCCTGCTGCTTCTCTTCTTGTGGATGCTCTTCCCGGAGAGC
GAGTATCAGTCACTCGCCCAGTCCGAGCTCGCCGCCAGCCGGCTCGCGCGCTACCGCGAGGCCCTCGATACCCTC
GGCGCTTCGTCCTGGGGCGACTTTTCGCCCGATGAGCTCCATGAAGCCACTGCAGATTCGAACGATGCCGCACCA
GATATCACTTCCGATGCCGTCCCCGACGCCGTCCCCGACGCCGCTGCCAACGCCACCTCCCACTTTATCAACCTC
ACCGGCTTCCGCCAAGTCGACGGCTTCGCCTGGGAGGATCTCGCCAGCTTCCGCGAAAAGGCCTTGCGCCTCAGC
CATCACGCCATGCCTCTGGTGGCCGGCCGTCAGCTTTGGGACGTGGCACAGGGCGAGGCTGTCTGGGCCAACGCA
TCCGGCACCCTCCGCGGCGACTGGGTTCGCCGTCCCGGCTCCGTCTCACGCCGCTACGACAATTACAACTTGAGC
CTCAGTGTTCCGGACATGGCATGGGCTGGCGAACACGCTGAATGGGCGCGCAATATGACGGGAGACGCCGGTCGT
ATGACGCTCCGCCTCGAAGCGAACCGTACCGTGACCAAATATGACGACATGGCCCCCGGCACAAGCCCTCTCTCC
GGCGGCGTCATCCGCGATGTTAGGGGCACTGTTACAGTCGAGGACACGAACGGCTCCGGTCACAACTGGGAGATG
CGCCTCTGGGGGGTCCATTGGCCGCGTCAGGGCGTTATCCTCATGACGACGACGAGCGAAAAGTTCGAGGGCATC
TTTGGCCTGCCACACCTAGCTCCAGGTCCCGATTTCTTCCTTTCGAGTCAGACGTTACTCAACAGCACGCTCAAC
AGCGTCATCACCAGGAAGCAACACAACATCAACCTCGACCCTAACATGCCTTGGAACTCGGACGTCGACAACATG
CAATACACGGCCTATCCCTCGCCACACTGTGAATTCATCATGTACGCCCAGGTCTACCCGCCCATAGAGCGCGCT
TCACCGGCAGCTGGCGGGACCGACGGCTCCGAAGGCATCATCCGCGCCATCGAGGCGGAGCTCGAGAACCCCCTG
GGCGCACCCATCGGCTCCGTTCCGCGACTCAAGCTGTCGGCCGTCATCTACTCGCCTGATTGCGCATTCTTCCTC
GAGTCCAAGGGTCCGCCTGACTTTCCGCCGACGGACAGCAGCCACTTGGTGGGCATGAAGACGGAGGTCCATCTC
CGTCAGGTTCAAAGGTGGATCATCGCCTTCGCCCTCGTCGTCTTCTTTCAAGTATATCTATTCAAGAATCAGATG
AAGGAGACGTTTACGCCTTCGACAATGGGTCGCATCAGCTTCTGGACCTTGAGCGCCATGGCCGTCGTCGACTGC
ATGACGTTTATCGCCGCCCTGACGTGGATGTCATCGGCGGGCGCTACCTTTTTGCCGACGCTGACTCTCGCGTTT
GCATCGTTCTCGTCGACGCTCATGGCCGGCTGCTTACTATCCAAGGTTCACGAGGTTCAACTGCCTGAAGGACGC
CTTCGACGGGAGGCCGGTCCGGGCGACGGCGGTGCGGCCCCGACGGCGACTCCGCCGAGACCAGTGCCACCGGCG
TCCGAACCGGCGCCCGCGACGTCGCTCTTGGGGCTCGTAACGCTGCCGTCGGACCAGGATATCGGCGCTGAGATG
GCGATGACGCGGTTGCCGTCGCCGCAGTCGTTCCAAAACCGGCTGGGCCGCTTGCTCCTCTTCACGCTATGCGTC
ACCTTGGTGGCCGTGTCGTCATCGACGTGGCATCCCCTTGCGCGTTCTTTCTTCCTTAACCTGTGTGCCTTTGCC
TACCTGTCGATGTGGGTGCCGCAGATCTATCGCAACACGATGCGAAACTGCAGACGGGCAATGAGGTGGCCGTTC
GTGGCCGGACAAACAACACTGCGGCTGCTGCCGGTGGCCTACTTCTGGGTAAAGGAGGACAACTTCCTGTACGCG
CGGGCGGACAAAGCGGCCTTTTGCGTTCTCTTGGCCTGGATCTGGCTGCAGTTGGCGATATTGGCGGTGCAGGAG
GTTATGGGTCCACGCTTCTGCATACCGGCCAGCTGGACGCCCGACGGTTGGGATTATCACCCCGTTCTGGGCGAG
GACGCGGTCGAGGCGGGCTGCCTGCCGATCGGACTGGTGACGGACGATTCGCGGAGGCGAGGCAGCAACGCGTCA
CTTAAGCGCGGCAATGTGCGTGCCATCGACTGCGCCATCTGCCACGAGGCGCTCGAGGTTCCGGTACTCAAGGCC
GGCGACGACGACGACGGCAGCGTGGCGAGCGTCTTTGCGAGGAGACTGTACATGATGACGCCTTGCCGGCACATC
TTCCACACGCACTGCTTGGAAGGCTGGATGAGAGTCCGGCTGCAGTGTCCCATCTGCCGGGAGGATCTGCCGCCG
ATATGATGGGAAGTCTCTGAACGGGGCGTCTCTTGGTGGGTTCTTGCAAAGCAGCGATCTGTGCCGCTCTACTCA
CCTCCCTATAGCAGGTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail