Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05079
Gene name
Locationscaffold_05:2444234..2445796
Strand+
Gene length (bp)1562
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 2.7E-29 83 187
PF00085 Thioredoxin Thioredoxin 1.1E-20 204 308
PF07749 ERp29 Endoplasmic reticulum protein ERp29, C-terminal domain 5.6E-26 326 418
PF13098 Thioredoxin_2 Thioredoxin-like domain 8.4E-08 97 168
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 9.5E-07 80 197

GO

GO Term Description Terminal node
GO:0005783 endoplasmic reticulum Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.2453 0.1453 0.2923 0.1382 0.2461 0.0236 0.7015 0.2496 0.1183 0.0353

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1620
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7148
Ophiocordyceps australis map64 (Brazil) OphauB2|3607
Ophiocordyceps camponoti-floridani Ophcf2|05079 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3469
Ophiocordyceps kimflemingae Ophio5|5207
Ophiocordyceps subramaniannii Hirsu2|1284

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05079
MMKQFLVEPHHPHRVSATLGRIVPDHPTVFRSYIPTYIRTHTHTLKGPLWHFPELQTTTMVLMKKSFLLTVVSAV
AVAASSAVIDLTPANFDKVVLKSGKPTLVEFFAPWCGHCKKLAPVYEELAASFEHAKDKVQIAKVDADAERSLGK
RFDIQGFPTIKWFDGKSEKPEEYNEGRDLDSLSAFVTKKTSVKLKKKPEMPSNVVMLNDETFAKTIGKKKNALVA
FTAPWCGHCKTLAPTWEVVAGVFALDEDVVIAKVNCEAPDSKAIAESQGVASYPTIKWFAAGSEEGVLYEAARSE
QGIIDYINEKAGTHRVPGGGLGPVAGTVATLDSLVAKFVGGDKLADVAAEVQKEAAEIKDSAQQKYAQYYVRIFE
KLATSDSYAAKELARLDGMLIKGGLAPAKRDEFQRKTNVLRKFVDKVSEIKDEL*
Coding >Ophcf2|05079
ATGATGAAACAGTTTTTAGTGGAGCCTCACCATCCTCACCGAGTTAGCGCCACGCTCGGGCGGATAGTCCCGGAT
CATCCTACGGTTTTCCGATCATACATACCTACATACATACGTACACACACACATACACTTAAGGGTCCTCTCTGG
CATTTTCCAGAGCTGCAAACGACCACCATGGTCCTGATGAAAAAGAGCTTTCTGCTCACGGTCGTTTCGGCCGTG
GCAGTTGCGGCTTCTTCCGCCGTCATCGACCTGACGCCTGCCAACTTTGACAAAGTGGTGCTCAAGTCGGGCAAG
CCAACGCTGGTCGAGTTCTTCGCCCCCTGGTGCGGCCACTGCAAGAAGCTGGCTCCCGTGTACGAGGAGCTGGCT
GCTTCCTTCGAGCATGCCAAGGACAAGGTGCAGATTGCAAAGGTGGACGCCGATGCGGAGCGCTCGCTGGGCAAG
CGGTTCGACATCCAGGGCTTTCCTACGATCAAGTGGTTTGATGGCAAGTCGGAGAAGCCTGAAGAGTACAACGAA
GGTCGTGACTTGGATTCTCTGTCGGCTTTCGTCACGAAGAAGACGAGCGTGAAGCTCAAGAAGAAGCCCGAGATG
CCCAGCAATGTCGTCATGCTCAACGATGAGACGTTTGCGAAGACTATCGGCAAGAAGAAGAACGCCTTGGTCGCC
TTTACTGCGCCGTGGTGCGGACACTGCAAGACTCTGGCTCCTACTTGGGAGGTTGTTGCCGGAGTCTTTGCCCTC
GACGAGGATGTCGTCATAGCCAAGGTCAACTGCGAGGCTCCGGACAGCAAGGCGATCGCCGAGTCACAGGGCGTG
GCCTCATATCCGACCATCAAGTGGTTCGCCGCCGGAAGCGAGGAAGGCGTTCTCTACGAGGCAGCCAGGTCGGAG
CAGGGCATCATCGACTACATCAACGAGAAGGCCGGCACGCACAGAGTGCCCGGAGGCGGTCTTGGTCCCGTGGCC
GGCACCGTCGCCACGCTGGACTCCCTGGTGGCCAAGTTTGTGGGAGGCGACAAGCTGGCGGACGTGGCGGCCGAG
GTGCAGAAGGAGGCGGCCGAGATCAAGGATAGCGCGCAGCAAAAATACGCCCAGTATTACGTGCGCATCTTTGAG
AAGCTTGCGACCAGCGACAGCTATGCTGCCAAGGAGCTGGCCAGACTCGACGGCATGCTCATCAAGGGCGGCCTC
GCACCGGCCAAGCGCGACGAGTTCCAGCGCAAGACCAACGTGCTGCGCAAGTTTGTCGACAAGGTTTCCGAGATC
AAAGACGAGCTTTAG
Transcript >Ophcf2|05079
ATGATGAAACAGTTTTTAGTGGAGCCTCACCATCCTCACCGAGTTAGCGCCACGCTCGGGCGGATAGTCCCGGAT
CATCCTACGGTTTTCCGATCATACATACCTACATACATACGTACACACACACATACACTTAAGGGTCCTCTCTGG
CATTTTCCAGAGCTGCAAACGACCACCATGGTCCTGATGAAAAAGAGCTTTCTGCTCACGGTCGTTTCGGCCGTG
GCAGTTGCGGCTTCTTCCGCCGTCATCGACCTGACGCCTGCCAACTTTGACAAAGTGGTGCTCAAGTCGGGCAAG
CCAACGCTGGTCGAGTTCTTCGCCCCCTGGTGCGGCCACTGCAAGAAGCTGGCTCCCGTGTACGAGGAGCTGGCT
GCTTCCTTCGAGCATGCCAAGGACAAGGTGCAGATTGCAAAGGTGGACGCCGATGCGGAGCGCTCGCTGGGCAAG
CGGTTCGACATCCAGGGCTTTCCTACGATCAAGTGGTTTGATGGCAAGTCGGAGAAGCCTGAAGAGTACAACGAA
GGTCGTGACTTGGATTCTCTGTCGGCTTTCGTCACGAAGAAGACGAGCGTGAAGCTCAAGAAGAAGCCCGAGATG
CCCAGCAATGTCGTCATGCTCAACGATGAGACGTTTGCGAAGACTATCGGCAAGAAGAAGAACGCCTTGGTCGCC
TTTACTGCGCCGTGGTGCGGACACTGCAAGACTCTGGCTCCTACTTGGGAGGTTGTTGCCGGAGTCTTTGCCCTC
GACGAGGATGTCGTCATAGCCAAGGTCAACTGCGAGGCTCCGGACAGCAAGGCGATCGCCGAGTCACAGGGCGTG
GCCTCATATCCGACCATCAAGTGGTTCGCCGCCGGAAGCGAGGAAGGCGTTCTCTACGAGGCAGCCAGGTCGGAG
CAGGGCATCATCGACTACATCAACGAGAAGGCCGGCACGCACAGAGTGCCCGGAGGCGGTCTTGGTCCCGTGGCC
GGCACCGTCGCCACGCTGGACTCCCTGGTGGCCAAGTTTGTGGGAGGCGACAAGCTGGCGGACGTGGCGGCCGAG
GTGCAGAAGGAGGCGGCCGAGATCAAGGATAGCGCGCAGCAAAAATACGCCCAGTATTACGTGCGCATCTTTGAG
AAGCTTGCGACCAGCGACAGCTATGCTGCCAAGGAGCTGGCCAGACTCGACGGCATGCTCATCAAGGGCGGCCTC
GCACCGGCCAAGCGCGACGAGTTCCAGCGCAAGACCAACGTGCTGCGCAAGTTTGTCGACAAGGTTTCCGAGATC
AAAGACGAGCTTTAG
Gene >Ophcf2|05079
ATGATGAAACAGTTTTTAGTGGAGCCTCACCATCCTCACCGAGTTAGCGCCACGCTCGGGCGGATAGGTAGGTAC
GTATGTACATATGTATGTACTCTTTCGTCACTCAAACCGTTTGGCCGCTTTCTGCCGAAGTTGATGAACTTGCAA
CCTGGCAGCTCCACCATATCGAGACGGAAATAAGTCCCGGATCATCCTACGGTTTTCCGATCATACATACCTACA
TACATACGTACACACACACATACAGTAAGTGACATTCATCTCATTCAAGAGGAAGACGACGTTGTGCGCTCTTTG
CCCTCGGTGGCTGTCGGTTCACACGCAGCGCAGCTTAAGGGTCCTCTCTGGCATTTTCCAGAGCTGCAAACGACC
ACCATGGTCCTGATGAAAAAGAGCTTTCTGCTCACGGTCGTTTCGGCCGTGGCAGTTGCGGCTTCTTCCGCCGTC
ATCGACCTGACGCCTGCCAACTTTGACAAAGTGGTGCTCAAGTCGGGCAAGCCAACGCTGGTCGAGTTCTTCGCC
CCCTGGTGCGGCCACTGCAAGAAGCTGGCTCCCGTGTACGAGGAGCTGGCTGCTTCCTTCGAGCATGCCAAGGAC
AAGGTGCAGATTGCAAAGGTGGACGCCGATGCGGAGCGCTCGCTGGGCAAGCGGTTCGACATCCAGGGCTTTCCT
ACGATCAAGTGGTTTGATGGCAAGTCGGAGAAGCCTGAAGAGTACAACGAAGGTCGTGACTTGGATTCTCTGTCG
GCTTTCGTCACGAAGAAGACGAGCGTGAAGCTCAAGAAGAAGCCCGAGATGCCCAGCAATGTCGTCATGCTCAAC
GATGAGACGTTTGCGAAGACTATCGGCAAGAAGAAGAACGCCTTGGTCGCCTTTACTGCGCCGTGGTGCGGACGT
GAGTACATGACGATTGGCGACATGAAGGGGTGAGGAGAGAACGCGCCGCTGACGGTGGCTTCCCACAAGACTGCA
AGACTCTGGCTCCTACTTGGGAGGTTGTTGCCGGAGTCTTTGCCCTCGACGAGGATGTCGTCATAGCCAAGGTCA
ACTGCGAGGCTCCGGACAGCAAGGCGATCGCCGAGTCACAGGGCGTGGCCTCATATCCGACCATCAAGTGGTTCG
CCGCCGGAAGCGAGGAAGGCGTTCTCTACGAGGCAGCCAGGTCGGAGCAGGGCATCATCGACTACATCAACGAGA
AGGCCGGCACGCACAGAGTGCCCGGAGGCGGTCTTGGTCCCGTGGCCGGCACCGTCGCCACGCTGGACTCCCTGG
TGGCCAAGTTTGTGGGAGGCGACAAGCTGGCGGACGTGGCGGCCGAGGTGCAGAAGGAGGCGGCCGAGATCAAGG
ATAGCGCGCAGCAAAAATACGCCCAGTATTACGTGCGCATCTTTGAGAAGCTTGCGACCAGCGACAGCTATGCTG
CCAAGGAGCTGGCCAGACTCGACGGCATGCTCATCAAGGGCGGCCTCGCACCGGCCAAGCGCGACGAGTTCCAGC
GCAAGACCAACGTGCTGCGCAAGTTTGTCGACAAGGTTTCCGAGATCAAAGACGAGCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail