Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05077
Gene name
Locationscaffold_05:2440315..2441366
Strand-
Gene length (bp)1051
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07543 PGA2 Protein trafficking PGA2 1.2E-37 88 211

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.2228 0.2238 0.1066 0.0801 0.553 0.0724 0.7523 0.1208 0.2006 0.2593

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1619
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7146
Ophiocordyceps australis map64 (Brazil) OphauB2|3609
Ophiocordyceps camponoti-floridani Ophcf2|05077 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3472
Ophiocordyceps kimflemingae Ophio5|5209
Ophiocordyceps subramaniannii Hirsu2|1281

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05077
MSHYCTHVTFGMFYLRELLFTHYLELPARIACQPARLAVNSPALDAIEAYRGHVGGVQAMDNQQQQPELNALGKL
VARVVEYGHNASNNLQDSFSNLSLQSWIRLIVIVGGYMLLRPYVMKLATKTAVRKLEEEDAKSRSAVKAEPQLTP
NEFRGIKEKLYEMPDEGDGTGADWGSKARTRQRQMLKDLLDEEERRRAAENEDADIQEFLED*
Coding >Ophcf2|05077
ATGAGTCATTACTGCACTCACGTGACGTTTGGAATGTTCTACTTACGCGAGCTTCTTTTTACACACTACCTAGAA
TTACCAGCAAGGATTGCTTGTCAGCCAGCTCGCCTCGCGGTGAATTCGCCCGCCCTCGACGCCATCGAGGCTTAC
CGAGGCCACGTGGGCGGCGTACAAGCGATGGACAACCAGCAGCAGCAGCCGGAGCTCAACGCCCTTGGCAAGCTG
GTCGCCCGTGTGGTCGAGTACGGTCACAACGCCAGTAACAACCTGCAGGATAGCTTTTCCAATCTCTCACTGCAA
TCTTGGATCCGTCTCATTGTCATTGTCGGAGGGTACATGCTTCTGCGGCCATACGTCATGAAGCTGGCTACCAAG
ACTGCGGTCCGCAAGCTGGAAGAGGAAGACGCCAAGTCGCGGAGCGCAGTTAAAGCCGAGCCGCAATTAACGCCA
AACGAGTTTCGTGGCATCAAAGAGAAGCTATACGAGATGCCTGACGAAGGCGATGGGACCGGGGCCGACTGGGGA
AGTAAGGCAAGGACGCGGCAGCGGCAGATGCTCAAGGACCTTCTCGATGAGGAAGAGAGACGGCGAGCGGCAGAA
AACGAGGACGCCGATATTCAGGAGTTCTTGGAGGACTGA
Transcript >Ophcf2|05077
ATGAGTCATTACTGCACTCACGTGACGTTTGGAATGTTCTACTTACGCGAGCTTCTTTTTACACACTACCTAGAA
TTACCAGCAAGGATTGCTTGTCAGCCAGCTCGCCTCGCGGTGAATTCGCCCGCCCTCGACGCCATCGAGGCTTAC
CGAGGCCACGTGGGCGGCGTACAAGCGATGGACAACCAGCAGCAGCAGCCGGAGCTCAACGCCCTTGGCAAGCTG
GTCGCCCGTGTGGTCGAGTACGGTCACAACGCCAGTAACAACCTGCAGGATAGCTTTTCCAATCTCTCACTGCAA
TCTTGGATCCGTCTCATTGTCATTGTCGGAGGGTACATGCTTCTGCGGCCATACGTCATGAAGCTGGCTACCAAG
ACTGCGGTCCGCAAGCTGGAAGAGGAAGACGCCAAGTCGCGGAGCGCAGTTAAAGCCGAGCCGCAATTAACGCCA
AACGAGTTTCGTGGCATCAAAGAGAAGCTATACGAGATGCCTGACGAAGGCGATGGGACCGGGGCCGACTGGGGA
AGTAAGGCAAGGACGCGGCAGCGGCAGATGCTCAAGGACCTTCTCGATGAGGAAGAGAGACGGCGAGCGGCAGAA
AACGAGGACGCCGATATTCAGGAGTTCTTGGAGGACTGA
Gene >Ophcf2|05077
ATGAGTCATTACTGCACTCACGTGACGTTTGGAATGTTCTACTTACGCGGTCCCTATAATTTAGCAACACAGCTA
GCATAACCGAGGCGACGCTCAGTATCATTAATTCCATACTTTTTGTCCATCTTAACAGCTTACCGAGAGACGCTA
AGAAAGCCCCTGAAGAACCGGAAAACCCCCTCATATTCGATTAAGCCTCTTAGCGGGATATGTAGGTCAGGTAGC
TGGGCAGAATAGTCGGTTAGAAAATCGGCTAAAAGAGCTTCTTTTTACACACTACCTAGGTACCTTTCCCCTGCG
CTTCCGGACTGACTTCAATCGCAATTGGTCTGTAAACACAGAGACGACAGACTTTGTCTACTGTAGTGAACAGCA
GTTGACGACAGGCGTTTACTTGAGCGCCAAATACCTAATTGTGATCCAGAATTACCAGCAAGGATTGCTTGTCAG
CCAGCTCGCCTCGCGGTGAATTCGCCCGCCCTCGACGCCATCGAGGTCCCTTACCGACAGCGGAGGACTACGAAG
GCTACGATACGATACCATCATCTCAATTCAGGCTTACCGAGGCCACGTGGGCGGCGTACAAGCGATGGACAACCA
GCAGCAGCAGCCGGAGCTCAACGCCCTTGGCAAGCTGGTCGCCCGTGTGGTCGAGTACGGTCACAACGCCAGTAA
CAACCTGCAGGATAGCTTTTCCAATCTCTCACTGCAATCTTGGATCCGTCTCATTGTCATTGTCGGAGGGTACAT
GCTTCTGCGGCCATACGTCATGAAGCTGGCTACCAAGACTGCGGTCCGCAAGCTGGAAGAGGAAGACGCCAAGTC
GCGGAGCGCAGTTAAAGCCGAGCCGCAATTAACGCCAAACGAGTTTCGTGGCATCAAAGAGAAGCTATACGAGAT
GCCTGACGAAGGCGATGGGACCGGGGCCGACTGGGGAAGTAAGGCAAGGACGCGGCAGCGGCAGATGCTCAAGGA
CCTTCTCGATGAGGAAGAGAGACGGCGAGCGGCAGAAAACGAGGACGCCGATATTCAGGAGTTCTTGGAGGACTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail