Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05075
Gene name
Locationscaffold_05:2433907..2435326
Strand+
Gene length (bp)1419
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 2.3E-19 100 265
PF00743 FMO-like Flavin-binding monooxygenase-like 4.1E-09 289 388
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.0E-11 12 301
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 4.9E-07 146 264
PF13454 NAD_binding_9 FAD-NAD(P)-binding 1.4E-04 15 53
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.4E-05 16 50

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0004497 monooxygenase activity No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.8403 0.4428 0.0282 0.0525 0.3614 0.0186 0.0475 0.2075 0.1586 0.4374

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1617
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7143
Ophiocordyceps australis map64 (Brazil) OphauB2|3613
Ophiocordyceps camponoti-floridani Ophcf2|05075 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3475
Ophiocordyceps kimflemingae Ophio5|5212
Ophiocordyceps subramaniannii Hirsu2|1276

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05075
MGSVSPTRFHVKQIAIIGAGPSGLATAKYLIAQHAFTLIVIFEQQHEIGGIWVPPPTGVNPPPSRCSVPQTNPFL
PPEPPVSVAEDRPRCRKVTYHYPSAVYDNLSANTVGSLMQFSDEPFPSSCLLFPSCDDMRDCILRYGHDVRHLIR
FRQQVTSLELLQNHGHDQWRLRTRDVVSDEAADHLFDAVVVASGHYSVPFIPDLNNSATFHDAHPSVIIHSREYR
SPESYRDKRVIVVGNGPSGVDIAGQINAVSKGKTLLSVKKATAPETLAFTGCDEASELVEFLVDERGVRFKDGRV
ETDVDAVIFCTGFLYSFPFLKDLHPKLIASGHGVHGLYKHMFYAQHPTLVFSALPSRSVPWPLSECQAAVVAAVW
SNQLELPPIEVMQGWSKDLHERVGEALQHLPPGGNHHYINELHDWAIKASYLGKQPPRWSESDGWQHLHMSEIRR
RFHKQGARAKTWADLGIEPGPS*
Coding >Ophcf2|05075
ATGGGATCCGTCTCCCCAACCCGCTTCCACGTGAAGCAAATCGCCATCATCGGCGCCGGTCCCTCCGGCTTAGCC
ACAGCTAAATACCTCATCGCCCAGCACGCCTTCACCCTCATCGTCATCTTCGAACAGCAGCATGAAATCGGCGGC
ATCTGGGTTCCTCCTCCTACAGGCGTGAATCCCCCCCCGTCGCGCTGCTCCGTGCCGCAGACGAATCCATTTCTA
CCTCCCGAACCCCCGGTGTCCGTCGCCGAAGACCGGCCCCGCTGCCGGAAGGTGACGTACCACTACCCGTCGGCC
GTATACGATAATCTCTCCGCCAACACGGTCGGTTCACTGATGCAATTCTCGGACGAACCTTTCCCGTCTTCTTGT
CTCTTATTTCCGTCCTGCGACGATATGAGGGACTGTATTCTTCGATACGGTCACGATGTCAGACACCTCATCCGC
TTCCGCCAACAGGTAACCTCCCTCGAGCTGTTACAGAATCACGGCCACGATCAATGGCGTCTACGGACTCGAGAC
GTGGTCAGTGACGAAGCGGCTGACCATCTCTTTGATGCCGTCGTCGTCGCTTCCGGACACTATTCCGTGCCCTTC
ATCCCCGACCTCAACAACAGCGCCACCTTTCACGACGCCCACCCCTCCGTCATCATCCACTCCAGAGAATACCGC
TCCCCCGAGAGCTACCGTGATAAAAGAGTCATTGTCGTGGGCAACGGCCCCTCGGGTGTCGACATCGCAGGCCAG
ATCAACGCCGTGTCCAAAGGCAAGACTTTACTCTCCGTCAAAAAAGCCACTGCACCCGAAACGCTTGCTTTCACC
GGCTGTGACGAGGCTTCCGAGCTGGTCGAGTTCCTCGTCGATGAGCGTGGTGTACGGTTCAAAGATGGCAGGGTC
GAAACCGACGTCGACGCTGTAATCTTTTGCACGGGATTCCTTTACAGCTTCCCCTTTCTTAAGGACCTGCATCCA
AAACTCATCGCCAGCGGCCACGGAGTTCACGGTCTTTACAAACACATGTTCTACGCCCAGCACCCCACCCTCGTC
TTTTCCGCCCTGCCCTCGAGATCCGTCCCCTGGCCCCTTTCTGAGTGTCAAGCCGCGGTCGTGGCCGCGGTCTGG
TCGAACCAGCTCGAGCTCCCACCGATAGAAGTGATGCAGGGCTGGAGTAAAGACTTGCACGAGAGGGTGGGCGAG
GCTCTTCAACATCTGCCTCCCGGCGGTAATCATCACTATATCAACGAGCTTCATGATTGGGCAATCAAGGCTTCG
TATTTGGGAAAACAACCGCCACGATGGAGCGAATCAGACGGATGGCAACATCTTCACATGAGCGAGATACGACGC
CGCTTTCACAAGCAAGGCGCCCGAGCAAAGACGTGGGCGGATTTGGGCATTGAACCAGGACCCAGTTGA
Transcript >Ophcf2|05075
ATGGGATCCGTCTCCCCAACCCGCTTCCACGTGAAGCAAATCGCCATCATCGGCGCCGGTCCCTCCGGCTTAGCC
ACAGCTAAATACCTCATCGCCCAGCACGCCTTCACCCTCATCGTCATCTTCGAACAGCAGCATGAAATCGGCGGC
ATCTGGGTTCCTCCTCCTACAGGCGTGAATCCCCCCCCGTCGCGCTGCTCCGTGCCGCAGACGAATCCATTTCTA
CCTCCCGAACCCCCGGTGTCCGTCGCCGAAGACCGGCCCCGCTGCCGGAAGGTGACGTACCACTACCCGTCGGCC
GTATACGATAATCTCTCCGCCAACACGGTCGGTTCACTGATGCAATTCTCGGACGAACCTTTCCCGTCTTCTTGT
CTCTTATTTCCGTCCTGCGACGATATGAGGGACTGTATTCTTCGATACGGTCACGATGTCAGACACCTCATCCGC
TTCCGCCAACAGGTAACCTCCCTCGAGCTGTTACAGAATCACGGCCACGATCAATGGCGTCTACGGACTCGAGAC
GTGGTCAGTGACGAAGCGGCTGACCATCTCTTTGATGCCGTCGTCGTCGCTTCCGGACACTATTCCGTGCCCTTC
ATCCCCGACCTCAACAACAGCGCCACCTTTCACGACGCCCACCCCTCCGTCATCATCCACTCCAGAGAATACCGC
TCCCCCGAGAGCTACCGTGATAAAAGAGTCATTGTCGTGGGCAACGGCCCCTCGGGTGTCGACATCGCAGGCCAG
ATCAACGCCGTGTCCAAAGGCAAGACTTTACTCTCCGTCAAAAAAGCCACTGCACCCGAAACGCTTGCTTTCACC
GGCTGTGACGAGGCTTCCGAGCTGGTCGAGTTCCTCGTCGATGAGCGTGGTGTACGGTTCAAAGATGGCAGGGTC
GAAACCGACGTCGACGCTGTAATCTTTTGCACGGGATTCCTTTACAGCTTCCCCTTTCTTAAGGACCTGCATCCA
AAACTCATCGCCAGCGGCCACGGAGTTCACGGTCTTTACAAACACATGTTCTACGCCCAGCACCCCACCCTCGTC
TTTTCCGCCCTGCCCTCGAGATCCGTCCCCTGGCCCCTTTCTGAGTGTCAAGCCGCGGTCGTGGCCGCGGTCTGG
TCGAACCAGCTCGAGCTCCCACCGATAGAAGTGATGCAGGGCTGGAGTAAAGACTTGCACGAGAGGGTGGGCGAG
GCTCTTCAACATCTGCCTCCCGGCGGTAATCATCACTATATCAACGAGCTTCATGATTGGGCAATCAAGGCTTCG
TATTTGGGAAAACAACCGCCACGATGGAGCGAATCAGACGGATGGCAACATCTTCACATGAGCGAGATACGACGC
CGCTTTCACAAGCAAGGCGCCCGAGCAAAGACGTGGGCGGATTTGGGCATTGAACCAGGACCCAGTTGA
Gene >Ophcf2|05075
ATGGGATCCGTCTCCCCAACCCGCTTCCACGTGAAGCAAATCGCCATCATCGGCGCCGGTCCCTCCGGCTTAGCC
ACAGCTAAATACCTCATCGCCCAGCACGCCTTCACCCTCATCGTCATCTTCGAACAGCAGCATGAAATCGGCGGC
ATCTGGGTTCCTCCTCCTACAGGCGTGAATCCCCCCCCGTCGCGCTGCTCCGTGCCGCAGACGAATCCATTTCTA
CCTCCCGAACCCCCGGTGTCCGTCGCCGAAGACCGGCCCCGCTGCCGGAAGGTGACGTACCACTACCCGTCGGCC
GTATACGATAATCTCTCCGCCAACACGGTCGGTTCACTGATGCAATTCTCGGACGAACCTTTCCCGTCTTCTTGT
CTCTTATTTCCGTCCTGCGACGATATGAGGGACTGTATTCTTCGATACGGTCACGATGTCAGACACCTCATCCGC
TTCCGCCAACAGGTAACCTCCCTCGAGCTGTTACAGAATCACGGCCACGATCAATGGCGTCTACGGACTCGAGAC
GTGGTCAGTGACGAAGCGGCTGACCATCTCTTTGATGCCGTCGTCGTCGCTTCCGGACACTATTCCGTGCCCTTC
ATCCCCGACCTCAACAACAGCGCCACCTTTCACGACGCCCACCCCTCCGTCATCATCCACTCCAGAGAATACCGC
TCCCCCGAGAGCTACCGTGATAAAAGAGTCATTGTCGTGGGCAACGGCCCCTCGGGTGTCGACATCGCAGGCCAG
ATCAACGCCGTGTCCAAAGGCAAGACTTTACTCTCCGTCAAAAAAGCCACTGCACCCGAAACGCTTGCTTTCACC
GGCTGTGACGAGGCTTCCGAGCTGGTCGAGTTCCTCGTCGATGAGCGTGGTGTACGGTTCAAAGATGGCAGGGTC
GAAACCGACGTCGACGCTGTAATCTTTTGCACGGGATTCCTTTACAGCTTCCCCTTTCTTAAGGACCTGCATCCA
AAACTCATCGCCAGCGGCCACGGAGTTCACGGTCTTTACAAACACATGTTCTACGCCCAGCACCCCACCCTCGTC
TTTTCCGCCCTGCCCTCGAGATCCGTCCCCTGGCCCCTTTCTGAGTGTCAAGCCGCGGTCGTGGCCGCGGTCTGG
TCGAACCAGCTCGAGCTCCCACCGATAGAAGTGATGCAGGGCTGGAGTAAAGACTTGCACGAGAGGGTGGGCGAG
GCTCTTCAACATCTGCCTCCCGGCGGTAATCATCACTATATCAACGAGCTTCATGATTGGGCAATCAAGGCTTCG
TATTTGGGAAAACAACCGCCACGATGGAGCGAATCAGACGGATGGCAACATCTTCACATGAGCGAGATACGACGC
CGCTTTCACAAGCAAGGCGCCCGAGCAAAGACGTGGGCGGATTTGGGCATTGAACCAGGACCCAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail