Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05070
Gene name
Locationscaffold_05:2416084..2417411
Strand+
Gene length (bp)1327
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.8E-19 87 236

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.2871 0.3863 0.5682 0.0781 0.3788 0.0737 0.1333 0.1192 0.0395 0.0584

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH16_4 5.5E-115 16 349

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup695
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6001
Ophiocordyceps australis map64 (Brazil) OphauB2|3621
Ophiocordyceps australis map64 (Brazil) OphauB2|3622
Ophiocordyceps camponoti-floridani Ophcf2|05070 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6601
Ophiocordyceps kimflemingae Ophio5|3632
Ophiocordyceps subramaniannii Hirsu2|1214

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05070
MVRPYRDLDYCLVYDDDFSSLDTDVWSREVQLDGFGTGAFDWTTTDPRNSYVDASGLHIVPTLTNETTTITNDQL
FANHTLDLLHDNSCTSRRNSSCFTHSDPITGSMIPPVRSARLSTRGRHSIRYGKVEVVAKLPRGDWIWPAIWMMP
EDSVYGDWPRSGEIDIMESRGNSREYPEGGNDMYYGTLHWGPTSETDSYWLTSGAKKIRRGDFSKDFHTFGIQWT
SRYIYFYLDSRIHQIKFVDFRPDRPLYRLGRFAQMAENQTLLADPWSSSKSTTGNAPFDQRFNLILSVAVGSRNG
WFPDRVGGKPWIDAAKNAQWMFWSAAKDWLPTWAPGDQRGMTVRSVKMWQQGPCGKPDLEL*
Coding >Ophcf2|05070
ATGGTCCGCCCTTACCGCGATCTCGACTACTGCCTCGTATACGACGACGACTTCTCCTCCCTCGACACCGACGTC
TGGTCTCGAGAAGTCCAGCTCGATGGTTTCGGAACCGGCGCTTTCGACTGGACGACGACGGATCCTCGTAACTCC
TACGTCGACGCCTCTGGTCTTCACATCGTTCCCACGCTCACCAACGAAACCACCACCATCACAAACGACCAGCTC
TTCGCCAACCATACCCTCGATCTCCTCCACGACAACTCCTGCACCTCCCGCCGAAACTCATCCTGCTTCACCCAC
AGCGATCCCATCACCGGCTCCATGATCCCCCCCGTACGCAGCGCCCGTCTCTCGACCCGCGGTCGACACAGCATC
CGCTACGGGAAAGTCGAAGTCGTCGCCAAGTTGCCGCGCGGCGACTGGATCTGGCCCGCCATCTGGATGATGCCC
GAGGACTCCGTCTACGGAGACTGGCCTCGCAGCGGCGAGATAGACATCATGGAAAGCAGAGGCAACTCCCGCGAG
TACCCAGAAGGAGGCAACGATATGTACTACGGCACACTTCACTGGGGCCCAACCTCGGAAACAGACTCGTACTGG
CTCACGTCAGGCGCCAAGAAGATCCGAAGAGGAGACTTCAGCAAAGACTTCCATACCTTTGGCATCCAATGGACA
TCCCGCTACATCTACTTCTACCTCGACTCCCGCATCCACCAGATCAAGTTCGTCGACTTCCGCCCAGACAGACCC
CTCTATCGGCTCGGCCGCTTCGCCCAAATGGCAGAGAACCAAACACTACTGGCAGACCCGTGGTCCTCCTCCAAG
TCGACGACTGGAAACGCCCCCTTCGACCAGCGCTTCAACCTCATCCTCAGCGTCGCCGTCGGTTCCCGCAACGGC
TGGTTCCCCGATCGCGTCGGAGGCAAGCCCTGGATCGACGCGGCCAAGAACGCGCAGTGGATGTTCTGGAGCGCT
GCAAAGGACTGGCTTCCTACATGGGCACCCGGAGACCAGCGAGGCATGACGGTCCGTTCCGTAAAGATGTGGCAG
CAGGGGCCATGCGGGAAGCCCGACCTCGAGCTGTAG
Transcript >Ophcf2|05070
ATGGTCCGCCCTTACCGCGATCTCGACTACTGCCTCGTATACGACGACGACTTCTCCTCCCTCGACACCGACGTC
TGGTCTCGAGAAGTCCAGCTCGATGGTTTCGGAACCGGCGCTTTCGACTGGACGACGACGGATCCTCGTAACTCC
TACGTCGACGCCTCTGGTCTTCACATCGTTCCCACGCTCACCAACGAAACCACCACCATCACAAACGACCAGCTC
TTCGCCAACCATACCCTCGATCTCCTCCACGACAACTCCTGCACCTCCCGCCGAAACTCATCCTGCTTCACCCAC
AGCGATCCCATCACCGGCTCCATGATCCCCCCCGTACGCAGCGCCCGTCTCTCGACCCGCGGTCGACACAGCATC
CGCTACGGGAAAGTCGAAGTCGTCGCCAAGTTGCCGCGCGGCGACTGGATCTGGCCCGCCATCTGGATGATGCCC
GAGGACTCCGTCTACGGAGACTGGCCTCGCAGCGGCGAGATAGACATCATGGAAAGCAGAGGCAACTCCCGCGAG
TACCCAGAAGGAGGCAACGATATGTACTACGGCACACTTCACTGGGGCCCAACCTCGGAAACAGACTCGTACTGG
CTCACGTCAGGCGCCAAGAAGATCCGAAGAGGAGACTTCAGCAAAGACTTCCATACCTTTGGCATCCAATGGACA
TCCCGCTACATCTACTTCTACCTCGACTCCCGCATCCACCAGATCAAGTTCGTCGACTTCCGCCCAGACAGACCC
CTCTATCGGCTCGGCCGCTTCGCCCAAATGGCAGAGAACCAAACACTACTGGCAGACCCGTGGTCCTCCTCCAAG
TCGACGACTGGAAACGCCCCCTTCGACCAGCGCTTCAACCTCATCCTCAGCGTCGCCGTCGGTTCCCGCAACGGC
TGGTTCCCCGATCGCGTCGGAGGCAAGCCCTGGATCGACGCGGCCAAGAACGCGCAGTGGATGTTCTGGAGCGCT
GCAAAGGACTGGCTTCCTACATGGGCACCCGGAGACCAGCGAGGCATGACGGTCCGTTCCGTAAAGATGTGGCAG
CAGGGGCCATGCGGGAAGCCCGACCTCGAGCTGTAG
Gene >Ophcf2|05070
ATGGTCCGCCCTTACCGCGATCTCGACTACTGCCTCGTATACGACGACGACTTCTCCTCCCTCGACACCGACGTC
TGGTCTCGAGAAGTCCAGCTCGATGGTTTCGGAACCGGCGCTTTCGACTGGACGACGACGGATCCTCGTAACTCC
TACGTCGACGCCTCTGGTCTTCACATCGTTCCCACGCTCACCAACGAAACCACCACCATCACAAACGACCAGCTC
TTCGCCAACCATACCCTCGATCTCCTCCACGACAACTCCTGCACCTCCCGCCGAAACTCATCCTGCTTCACCCAC
AGCGATCCCATCACCGGCTCCATGATCCCCCCCGTACGCAGCGCCCGTCTCTCGACCCGCGGTCGACACAGCATC
CGCTACGGGAAAGTCGAAGTCGTCGCCAAGTTGCCGCGCGGCGACTGGATCTGGCCCGCCATCTGTGCGTCTTTT
CCCCCCTTTTTCCTATTCATCTGCCCGTTCCCTACATACTTTTTATACTTGCTGACCGACGTCTTCGTGTGTAGG
GATGATGCCCGAGGACTCCGTCTACGGAGACTGGCCTCGCAGCGGCGAGATAGACATCATGGAAAGCAGAGGCAA
CTCCCGCGAGTACCCAGAAGGAGGCAACGATATGTACTACGGCACACTTCACTGGGGGTAAGATATCTCCCAATT
TCCCCCTTCTCATCTTTCAACAGCATAAACCCTTCCTTACCTCCCCCCCTTTATTAACAAACCTCCAGCCCAACC
TCGGAAACAGACTCGTACTGGCTCACGTCAGGCGCCAAGAAGATCCGAAGAGGAGACTTCAGCAAAGACTTCCAT
ACCTTTGGCATCCAATGGACATCCCGCTACATCTACTTCTACCTCGACTCCCGCATCCACCAGATCAAGTTCGTC
GACTTCCGCCCAGACAGACCCCTCTATCGGCTCGGCCGCTTCGCCCAAATGGCAGAGAACCAAACACTACTGGCA
GACCCGTGGTCCTCCTCCAAGTCGACGACTGGAAACGCCCCCTTCGACCAGCGCTTCAACCTCATCCTCAGCGTC
GCCGTCGGTTCCCGCAACGGCTGGTTCCCGTTAGTTTTCCAAACCCCCCCTCCCCTATCCGGCTATCCCGTTGCC
CATCCCGGCTAACGTGATGAGAAGCGATCGCGTCGGAGGCAAGCCCTGGATCGACGCGGCCAAGAACGCGCAGTG
GATGTTCTGGAGCGCTGCAAAGGACTGGCTTCCTACATGGGCACCCGGAGACCAGCGAGGCATGACGGTCCGTTC
CGTAAAGATGTGGCAGCAGGGGCCATGCGGGAAGCCCGACCTCGAGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail