Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05069
Gene name
Locationscaffold_05:2410592..2413613
Strand-
Gene length (bp)3021
Transcript length (bp)2793
Coding sequence length (bp)2793
Protein length (aa) 931

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 5.5E-46 549 766

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Transmembrane domain 0.1645 0.1232 0.0329 0.5222 0.0598 0.0106 0.4687 0.4546 0.5753 0.0035

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 297 319 22
2 332 354 22
3 742 764 22
4 777 799 22
5 819 841 22
6 871 893 22
7 903 925 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT2_Glyco_trans_2_3 1.5E-48 549 766

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup220
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4835
Ophiocordyceps australis 1348a (Ghana) OphauG2|7233
Ophiocordyceps australis map64 (Brazil) OphauB2|1479
Ophiocordyceps australis map64 (Brazil) OphauB2|3624
Ophiocordyceps camponoti-floridani Ophcf2|00995
Ophiocordyceps camponoti-floridani Ophcf2|05069 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|298
Ophiocordyceps camponoti-rufipedis Ophun1|5225
Ophiocordyceps kimflemingae Ophio5|3631
Ophiocordyceps subramaniannii Hirsu2|2492
Ophiocordyceps subramaniannii Hirsu2|3837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05069
MDSPPKSPAVGPGPDPLSRKTSYLGVSETSSQVNVGQTRPPTPSNGSYDDVFRYRTMVSYLYSRVVASGWIPAGI
NQDDCLGVMLRRSRGEYVASPDPAHALLVGAVIRLNLAVVVTMRPQMLDGILRSLAPGQTELRFKGGSQIQIVDS
LASVRAATVKKFQYAAICLQERLVLVWQDDLRHIIPTAMQMEERLLSLVSFVVSLVSSSHLVVNLGLTMENQKVW
GEARLPFNMLQLPSRAPSTLSSGFSSPNGASTPALEKGAPGLHTSESVQDPSSDPSLDRLESVARPVARTSALFI
GLAMVTAISLIFGVYSGQLFTESLLDHSYRRLGLMAFCPLLLCISLFFFQVVFTNIFQIIGPIGGVSTNSRYYSC
HKPCLPRAYADGFVPPKMTIQMPVYKEGMDSVIVPTIRSLQAAVSYYESHGGTANILINDDGLRAGISPEEAQKR
RDFYHDNNIGWVARPSHDGPEGFVRKGKFKKASNMNFALNTSQRVEAHLQDMVDARVAAGGSDLIDEADEADMYK
EALLRVLEENPLAQAGGDIRVGEIILIVDSDTRVPVNCLLYGAAEMYLSQEVAIVQHSTGVLQVSRDYFENGITY
FTNLVYTSIRFSIGCGEVAPFVGHNAFIRWQAVQDISSEDEDGHTAYWSEAHVSEDFDMALRLQMKGNVIRIATY
HNNEFKEGVSLTIYDEISRWKRYGFGVSELIFHPLYLWIFRGPFTPLFYTYLGSSIMLSSKISIMAYMCSYYALG
SALPLSVMNYFIVGWFRDDLASCYLTSWNVFLSLIVVFNASSPVALAVFRYRTGERSLLGALVENAKWMPMMTVF
FGGISYHIGTALLSHLLHIDMQWGATAKEKEDSNFFQEMPRIFRTFKYMYLLIFLLVAAIIYLGVWAPPDWAITD
FSVLVPLLINLTFHALSPLVLNPSLMIFNY*
Coding >Ophcf2|05069
ATGGACTCTCCGCCCAAGTCCCCGGCTGTCGGCCCTGGTCCTGATCCTCTTTCCAGGAAGACTTCGTATCTTGGT
GTTTCCGAGACGTCGAGTCAGGTCAATGTTGGGCAGACGAGGCCGCCTACGCCTTCTAACGGGTCTTATGATGAT
GTCTTTCGCTATCGTACTATGGTCAGCTACCTCTACAGCAGAGTGGTCGCCAGCGGTTGGATCCCGGCTGGCATC
AACCAAGATGACTGCCTGGGCGTGATGCTCCGACGGTCAAGGGGCGAATACGTAGCCTCGCCCGATCCGGCCCAC
GCACTTCTCGTCGGGGCCGTCATCAGGCTGAACCTAGCGGTCGTGGTGACGATGCGTCCGCAGATGCTCGACGGC
ATCCTCCGGTCTTTGGCTCCGGGACAGACGGAGCTGCGGTTCAAGGGCGGGTCGCAGATTCAGATTGTCGACTCG
TTGGCTTCCGTGAGGGCTGCTACCGTCAAGAAGTTTCAGTATGCGGCTATCTGTTTGCAGGAGAGGCTTGTCTTG
GTTTGGCAGGATGATTTGCGGCATATTATCCCGACGGCTATGCAGATGGAGGAGAGGCTGTTGTCGCTGGTGAGT
TTCGTCGTCTCCCTCGTCTCGTCGTCCCATCTCGTCGTCAACCTTGGACTGACCATGGAGAATCAAAAGGTTTGG
GGAGAGGCAAGACTTCCCTTCAATATGCTCCAGCTTCCGAGCCGCGCCCCCTCGACTCTATCCTCGGGCTTCTCC
AGTCCGAACGGCGCGTCGACGCCGGCGCTGGAAAAGGGAGCTCCGGGACTTCACACCAGCGAGAGCGTCCAGGAC
CCATCATCCGATCCGTCCTTGGACCGGCTCGAATCCGTGGCCCGGCCCGTGGCCCGGACGTCGGCTCTCTTCATC
GGTCTCGCCATGGTGACGGCCATCAGCCTCATCTTCGGCGTCTACTCCGGTCAACTCTTTACCGAATCTCTGCTC
GACCATTCGTATCGGAGACTGGGACTCATGGCGTTTTGTCCGCTGCTGTTGTGTATCAGCTTGTTCTTCTTTCAG
GTCGTCTTCACCAACATCTTTCAGATCATCGGTCCCATCGGCGGCGTCAGCACCAACTCGCGATACTACTCTTGT
CACAAGCCGTGTCTTCCGAGGGCTTACGCCGACGGCTTCGTCCCGCCCAAGATGACGATTCAGATGCCCGTCTAT
AAAGAGGGCATGGACTCCGTCATCGTCCCTACCATCCGCAGCTTACAGGCTGCCGTCTCGTACTACGAGTCCCAC
GGCGGAACGGCAAACATCCTCATCAACGACGACGGCCTCCGAGCAGGCATCTCCCCGGAAGAGGCCCAGAAACGA
CGCGACTTCTACCACGATAACAACATCGGATGGGTGGCACGCCCGAGCCACGACGGACCGGAGGGCTTCGTCCGG
AAGGGCAAGTTTAAGAAGGCCTCCAACATGAACTTTGCCCTCAACACCTCGCAGCGAGTCGAGGCTCACCTCCAG
GACATGGTCGATGCCAGAGTCGCGGCCGGGGGCTCGGACTTGATCGACGAGGCGGACGAGGCGGACATGTACAAG
GAGGCGCTCCTGAGAGTCTTGGAGGAGAATCCGTTGGCGCAGGCTGGGGGGGATATTCGCGTGGGGGAGATTATC
CTCATTGTTGACTCGGATACGCGCGTGCCCGTCAACTGTCTGCTCTACGGGGCGGCAGAGATGTATCTCAGTCAA
GAGGTGGCCATCGTTCAGCACTCGACAGGCGTCTTACAGGTTTCGCGAGATTACTTTGAAAACGGCATCACCTAC
TTCACCAACCTGGTCTACACGTCCATCCGCTTCTCCATCGGTTGCGGCGAGGTCGCCCCTTTTGTCGGACACAAC
GCCTTCATCAGGTGGCAAGCCGTGCAGGATATCAGCAGCGAGGACGAAGACGGCCATACAGCTTACTGGTCCGAA
GCCCACGTATCCGAAGACTTTGACATGGCTCTCCGGCTGCAGATGAAGGGCAATGTCATCCGCATAGCAACCTAC
CACAACAACGAGTTCAAAGAAGGCGTCTCGTTGACAATCTACGACGAAATCTCCCGCTGGAAACGCTACGGCTTC
GGTGTCAGCGAACTCATCTTTCACCCCCTTTACCTCTGGATCTTCCGCGGCCCCTTTACGCCCCTTTTCTACACC
TACCTCGGCTCCAGCATCATGCTCTCCTCCAAGATCTCCATCATGGCCTACATGTGTTCGTACTACGCTCTCGGA
TCCGCGCTTCCGCTATCAGTCATGAACTACTTCATCGTCGGTTGGTTCCGCGATGACCTGGCGTCGTGCTACCTC
ACCTCCTGGAACGTCTTCCTCTCCCTCATCGTCGTCTTCAACGCCTCCAGTCCCGTTGCCCTCGCCGTCTTCCGC
TACCGAACGGGCGAGCGCTCACTGCTGGGCGCCCTGGTGGAAAACGCGAAATGGATGCCCATGATGACCGTCTTC
TTCGGCGGAATCTCCTATCACATCGGAACCGCTCTTCTCTCTCACCTGCTACACATCGATATGCAATGGGGCGCG
ACCGCAAAGGAAAAGGAAGACAGCAACTTCTTTCAGGAGATGCCTCGTATCTTCCGCACCTTCAAGTACATGTAT
CTGCTCATCTTTCTGCTCGTCGCTGCCATCATCTATCTCGGTGTCTGGGCGCCTCCGGATTGGGCTATTACTGAC
TTTTCCGTCCTTGTTCCTTTGCTCATCAACTTGACCTTTCACGCCCTTTCGCCCCTGGTCTTGAACCCGAGCTTG
ATGATCTTCAACTATTGA
Transcript >Ophcf2|05069
ATGGACTCTCCGCCCAAGTCCCCGGCTGTCGGCCCTGGTCCTGATCCTCTTTCCAGGAAGACTTCGTATCTTGGT
GTTTCCGAGACGTCGAGTCAGGTCAATGTTGGGCAGACGAGGCCGCCTACGCCTTCTAACGGGTCTTATGATGAT
GTCTTTCGCTATCGTACTATGGTCAGCTACCTCTACAGCAGAGTGGTCGCCAGCGGTTGGATCCCGGCTGGCATC
AACCAAGATGACTGCCTGGGCGTGATGCTCCGACGGTCAAGGGGCGAATACGTAGCCTCGCCCGATCCGGCCCAC
GCACTTCTCGTCGGGGCCGTCATCAGGCTGAACCTAGCGGTCGTGGTGACGATGCGTCCGCAGATGCTCGACGGC
ATCCTCCGGTCTTTGGCTCCGGGACAGACGGAGCTGCGGTTCAAGGGCGGGTCGCAGATTCAGATTGTCGACTCG
TTGGCTTCCGTGAGGGCTGCTACCGTCAAGAAGTTTCAGTATGCGGCTATCTGTTTGCAGGAGAGGCTTGTCTTG
GTTTGGCAGGATGATTTGCGGCATATTATCCCGACGGCTATGCAGATGGAGGAGAGGCTGTTGTCGCTGGTGAGT
TTCGTCGTCTCCCTCGTCTCGTCGTCCCATCTCGTCGTCAACCTTGGACTGACCATGGAGAATCAAAAGGTTTGG
GGAGAGGCAAGACTTCCCTTCAATATGCTCCAGCTTCCGAGCCGCGCCCCCTCGACTCTATCCTCGGGCTTCTCC
AGTCCGAACGGCGCGTCGACGCCGGCGCTGGAAAAGGGAGCTCCGGGACTTCACACCAGCGAGAGCGTCCAGGAC
CCATCATCCGATCCGTCCTTGGACCGGCTCGAATCCGTGGCCCGGCCCGTGGCCCGGACGTCGGCTCTCTTCATC
GGTCTCGCCATGGTGACGGCCATCAGCCTCATCTTCGGCGTCTACTCCGGTCAACTCTTTACCGAATCTCTGCTC
GACCATTCGTATCGGAGACTGGGACTCATGGCGTTTTGTCCGCTGCTGTTGTGTATCAGCTTGTTCTTCTTTCAG
GTCGTCTTCACCAACATCTTTCAGATCATCGGTCCCATCGGCGGCGTCAGCACCAACTCGCGATACTACTCTTGT
CACAAGCCGTGTCTTCCGAGGGCTTACGCCGACGGCTTCGTCCCGCCCAAGATGACGATTCAGATGCCCGTCTAT
AAAGAGGGCATGGACTCCGTCATCGTCCCTACCATCCGCAGCTTACAGGCTGCCGTCTCGTACTACGAGTCCCAC
GGCGGAACGGCAAACATCCTCATCAACGACGACGGCCTCCGAGCAGGCATCTCCCCGGAAGAGGCCCAGAAACGA
CGCGACTTCTACCACGATAACAACATCGGATGGGTGGCACGCCCGAGCCACGACGGACCGGAGGGCTTCGTCCGG
AAGGGCAAGTTTAAGAAGGCCTCCAACATGAACTTTGCCCTCAACACCTCGCAGCGAGTCGAGGCTCACCTCCAG
GACATGGTCGATGCCAGAGTCGCGGCCGGGGGCTCGGACTTGATCGACGAGGCGGACGAGGCGGACATGTACAAG
GAGGCGCTCCTGAGAGTCTTGGAGGAGAATCCGTTGGCGCAGGCTGGGGGGGATATTCGCGTGGGGGAGATTATC
CTCATTGTTGACTCGGATACGCGCGTGCCCGTCAACTGTCTGCTCTACGGGGCGGCAGAGATGTATCTCAGTCAA
GAGGTGGCCATCGTTCAGCACTCGACAGGCGTCTTACAGGTTTCGCGAGATTACTTTGAAAACGGCATCACCTAC
TTCACCAACCTGGTCTACACGTCCATCCGCTTCTCCATCGGTTGCGGCGAGGTCGCCCCTTTTGTCGGACACAAC
GCCTTCATCAGGTGGCAAGCCGTGCAGGATATCAGCAGCGAGGACGAAGACGGCCATACAGCTTACTGGTCCGAA
GCCCACGTATCCGAAGACTTTGACATGGCTCTCCGGCTGCAGATGAAGGGCAATGTCATCCGCATAGCAACCTAC
CACAACAACGAGTTCAAAGAAGGCGTCTCGTTGACAATCTACGACGAAATCTCCCGCTGGAAACGCTACGGCTTC
GGTGTCAGCGAACTCATCTTTCACCCCCTTTACCTCTGGATCTTCCGCGGCCCCTTTACGCCCCTTTTCTACACC
TACCTCGGCTCCAGCATCATGCTCTCCTCCAAGATCTCCATCATGGCCTACATGTGTTCGTACTACGCTCTCGGA
TCCGCGCTTCCGCTATCAGTCATGAACTACTTCATCGTCGGTTGGTTCCGCGATGACCTGGCGTCGTGCTACCTC
ACCTCCTGGAACGTCTTCCTCTCCCTCATCGTCGTCTTCAACGCCTCCAGTCCCGTTGCCCTCGCCGTCTTCCGC
TACCGAACGGGCGAGCGCTCACTGCTGGGCGCCCTGGTGGAAAACGCGAAATGGATGCCCATGATGACCGTCTTC
TTCGGCGGAATCTCCTATCACATCGGAACCGCTCTTCTCTCTCACCTGCTACACATCGATATGCAATGGGGCGCG
ACCGCAAAGGAAAAGGAAGACAGCAACTTCTTTCAGGAGATGCCTCGTATCTTCCGCACCTTCAAGTACATGTAT
CTGCTCATCTTTCTGCTCGTCGCTGCCATCATCTATCTCGGTGTCTGGGCGCCTCCGGATTGGGCTATTACTGAC
TTTTCCGTCCTTGTTCCTTTGCTCATCAACTTGACCTTTCACGCCCTTTCGCCCCTGGTCTTGAACCCGAGCTTG
ATGATCTTCAACTATTGA
Gene >Ophcf2|05069
ATGGACTCTCCGCCCAAGTCCCCGGCTGTCGGCCCTGGTCCTGATCCTCTTTCCAGGAAGACTTCGTATCTTGGT
GTTTCCGAGACGTCGAGTCAGGTCAATGTTGGGCAGACGAGGCCGCCTACGCCTTCTAACGGGTCTTATGATGAT
GTCTTTCGCTATCGTACTGTGAGTCTCAGCTATGGAGGGTTTCCCTTCCCCCCCCGGGGGATGTTTACCCTGATG
GACTGACCGTTTTCTCCTAGATGGTCAGCTACCTCTACAGCAGAGTGGTCGCCAGCGGTTGGATCCCGGCTGGCA
TCAACCAAGATGACTGCCTGGGCGTGATGCTCCGACGGTCAAGGGGCGAATACGTAGCCTCGCCCGATCCGGCCC
ACGCACTTCTCGTCGGGGCCGTCATCAGGCTGAACCTAGCGGTCGTGGTGACGATGCGTCCGCAGATGCTCGACG
GCATCCTCCGGTCTTTGGCTCCGGGACAGACGGAGCTGCGGTTCAAGGGCGGGTCGCAGATTCAGATTGTCGACT
CGTTGGCTTCCGTGAGGGCTGCTACCGTCAAGAAGTTTCAGTATGCGGCTATCTGTTTGCAGGAGAGGCTTGTCT
TGGTTTGGCAGGATGATTTGCGGCATATTATCCCGACGGCTATGCAGATGGAGGAGAGGCTGTTGTCGCTGGTGA
GTTTCGTCGTCTCCCTCGTCTCGTCGTCCCATCTCGTCGTCAACCTTGGACTGACCATGGAGAATCAAAAGGTTT
GGGGAGAGGCAAGACTTCCCTTCAATATGCTCCAGCTTCCGAGCCGCGCCCCCTCGACTCTATCCTCGGGCTTCT
CCAGTCCGAACGGCGCGTCGACGCCGGCGCTGGAAAAGGGAGCTCCGGGACTTCACACCAGCGAGAGCGTCCAGG
ACCCATCATCCGATCCGTCCTTGGACCGGCTCGAATCCGTGGCCCGGCCCGTGGCCCGGACGTCGGCTCTCTTCA
TCGGTCTCGCCATGGTGACGGCCATCAGCCTCATCTTCGGCGTCTACTCCGGTCAACTCTTTACCGAATCTCTGC
TCGACCATTCGTATCGGAGACTGGGACTCATGGCGTTTTGTCCGCTGCTGTTGTGTATCAGCTTGTTCTTCTTTC
AGGTCGTCTTCACCAACATCTTTCAGATCATCGGTCCCATCGGCGGCGTCAGCACCAACTCGCGATACTACTCTT
GTCACAAGCCGTGTCTTCCGAGGGCTTACGCCGACGGCTTCGTCCCGCCCAAGATGACGATTCAGATGCCCGTCT
ATAAAGAGGGCATGGACTCCGTCATCGTCCCTACCATCCGCAGCTTACAGGCTGCCGTCTCGTACTACGAGTCCC
ACGGCGGAACGGCAAACATCCTCATCAACGACGACGGCCTCCGAGCAGGCATCTCCCCGGAAGAGGCCCAGAAAC
GACGCGACTTCTACCACGATAACAACATCGGATGGGTGGCACGCCCGAGCCACGACGGACCGGAGGGCTTCGTCC
GGAAGGGCAAGTTTAAGAAGGCCTCCAACATGAACTTTGCCCTCAACACCTCGCAGCGAGTCGAGGCTCACCTCC
AGGACATGGTCGATGCCAGAGTCGCGGCCGGGGGCTCGGACTTGATCGACGAGGCGGACGAGGCGGACATGTACA
AGGAGGCGCTCCTGAGAGTCTTGGAGGAGAATCCGTTGGCGCAGGCTGGGGGGGATATTCGCGTGGGGGAGATTA
TCCTCATTGTTGACTCGGATACGCGCGTGGTGAGTAGCCCGTCACTCTGCCTTCTCTCTTTTGAATCCCCTTGGG
AGTTGTTTGCCTGCTGATACTGCTTTACAGCCCGTCAACTGTCTGCTCTACGGGGCGGCAGAGATGTATCTCAGT
CAAGAGGTGGCCATCGTTCAGCACTCGACAGGCGTCTTACAGGTTTCGCGAGATTACTTTGAAAACGGCATCACC
TACTTCACCAACCTGGTCTACACGTCCATCCGCTTCTCCATCGGTTGCGGCGAGGTCGCCCCTTTTGTCGGACAC
AACGCCTTCATCAGGTGGCAAGGTGAGCAGCGTTGGAAAAACCCGTCACGTCCCATAACCCCCCCTGAGATCCAT
GAGCTGATGGTTACGTGTACAGCCGTGCAGGATATCAGCAGCGAGGACGAAGACGGCCATACAGCTTACTGGTCC
GAAGCCCACGTATCCGAAGACTTTGACATGGCTCTCCGGCTGCAGATGAAGGGCAATGTCATCCGCATAGCAACC
TACCACAACAACGAGTTCAAAGAAGGCGTCTCGTTGACAATCTACGACGAAATCTCCCGCTGGAAACGCTACGGC
TTCGGTGTCAGCGAACTCATCTTTCACCCCCTTTACCTCTGGATCTTCCGCGGCCCCTTTACGCCCCTTTTCTAC
ACCTACCTCGGCTCCAGCATCATGCTCTCCTCCAAGATCTCCATCATGGCCTACATGTGTTCGTACTACGCTCTC
GGATCCGCGCTTCCGCTATCAGTCATGAACTACTTCATCGTCGGTTGGTTCCGCGATGACCTGGCGTCGTGCTAC
CTCACCTCCTGGAACGTCTTCCTCTCCCTCATCGTCGTCTTCAACGCCTCCAGTCCCGTTGCCCTCGCCGTCTTC
CGCTACCGAACGGGCGAGCGCTCACTGCTGGGCGCCCTGGTGGAAAACGCGAAATGGATGCCCATGATGACCGTC
TTCTTCGGCGGAATCTCCTATCACATCGGAACCGCTCTTCTCTCTCACCTGCTACACATCGATATGCAATGGGGC
GCGACCGCAAAGGAAAAGGAAGACAGCAACTTCTTTCAGGAGATGCCTCGTATCTTCCGCACCTTCAAGTACATG
TATCTGCTCATCTTTCTGCTCGTCGCTGCCATCATCTATCTCGGTGTCTGGGCGCCTCCGGATTGGGCTATTACT
GACTTTTCCGTCCTTGTTCCTTTGCTCATCAACTTGACCTTTCACGCCCTTTCGCCCCTGGTCTTGAACCCGAGC
TTGATGATCTTCAACTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail