Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05065
Gene name
Locationscaffold_05:2398886..2400552
Strand+
Gene length (bp)1666
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08068 DKCLD DKCLD (NUC011) domain 5.7E-31 24 81
PF01509 TruB_N TruB family pseudouridylate synthase (N terminal domain) 1.1E-20 85 202
PF16198 TruB_C_2 tRNA pseudouridylate synthase B C-terminal domain 1.7E-22 203 269
PF01472 PUA PUA domain 6.8E-20 273 345

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0003723 RNA binding Yes
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4036 0.7478 0.3011 0.0668 0.071 0.0418 0.0917 0.0196 0.0802 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3228
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4839
Ophiocordyceps australis map64 (Brazil) OphauB2|3628
Ophiocordyceps camponoti-floridani Ophcf2|05065 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3947
Ophiocordyceps kimflemingae Ophio5|4576
Ophiocordyceps subramaniannii Hirsu2|5829

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05065
MELVKRKDEEYAIKPQAFTPALDTSSWPLLLKNYDRLLIRTGHFTPLVNGCSPLKRDIKSYISSGVINLDKPSNP
SSHEVVAWVKRILRVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGAGKEYVCVIRLHDKVPGGEAQFARALE
TLTGALFQRPPLISAVKRQLRIRTIHESRLIEFDNDRHLGVFWVSCEAGTYIRTLCVHLGLLLGVGAHMQELRRV
RSGAMDESKQLVTLHDVLDAQWMMDNTRDESYLRKVISPLETLLTSYKRLVVKDSAVNAVCYGAKLMLPGLLRYE
AGIEHHDEVVLMTTKGEAIALGIAHMATVEMSTCDHGIVARVKRCIMERDLYPRRWGLGPVAMEKKKLKADGKLD
KHGRPNDATPSTWTAGYKDYGPSADDSGTAAAAAAAAGAAAGAPPPPPTPKATAPQPEAATAMEVEKPTPAEEGD
KKKRKKHEGETPEEKAERKRRKADKKAAKAAKKSATKDDAAPDDGDSD*
Coding >Ophcf2|05065
ATGGAGCTCGTCAAGAGAAAAGACGAAGAGTACGCCATCAAGCCGCAGGCCTTTACGCCCGCCCTCGATACGAGC
TCGTGGCCGCTGCTGCTCAAGAACTACGATAGACTTCTCATTCGGACGGGGCATTTTACACCCCTTGTCAATGGG
TGCTCGCCACTGAAACGCGATATCAAGTCGTACATCAGTTCCGGCGTGATCAATCTCGACAAGCCGTCTAACCCT
TCGAGCCACGAGGTCGTCGCCTGGGTCAAGCGCATCCTACGCGTCGAAAAGACGGGTCACAGCGGCACCCTCGAT
CCCAAGGTCACCGGCTGCCTCATCGTCTGCATCGACCGCGCCACCCGTCTCGTCAAATCGCAGCAAGGCGCGGGG
AAAGAATACGTCTGCGTCATTCGGCTGCACGACAAGGTCCCCGGCGGTGAAGCTCAGTTCGCGCGCGCGCTCGAG
ACTCTTACGGGCGCTCTGTTTCAGCGTCCGCCTCTCATCTCGGCTGTTAAGCGGCAGCTGCGTATCCGCACCATC
CACGAGAGCCGGCTCATCGAGTTCGATAATGATCGTCATCTTGGTGTCTTTTGGGTTAGCTGCGAGGCCGGCACT
TACATTCGGACTCTGTGCGTTCATCTTGGTCTTCTCCTTGGCGTCGGCGCCCACATGCAGGAGCTGCGTCGCGTT
CGTAGCGGTGCCATGGACGAGTCCAAGCAGCTCGTTACTCTGCACGATGTCCTGGATGCTCAGTGGATGATGGAT
AATACGCGCGACGAGTCATATCTCCGCAAGGTCATCTCACCTCTGGAGACGCTGTTGACGTCCTACAAGCGCCTT
GTGGTCAAGGACAGCGCCGTCAACGCCGTCTGCTACGGCGCCAAACTGATGCTACCAGGTCTCCTGCGCTACGAG
GCCGGCATCGAACACCATGACGAAGTCGTACTCATGACAACAAAAGGCGAGGCCATCGCCCTGGGAATCGCCCAC
ATGGCCACGGTCGAAATGTCAACCTGCGACCACGGCATCGTCGCAAGGGTCAAGCGCTGCATCATGGAACGAGAC
CTCTACCCAAGACGCTGGGGTCTAGGCCCCGTAGCCATGGAAAAGAAGAAGCTCAAAGCCGACGGCAAACTCGAC
AAACACGGCCGCCCCAACGACGCAACCCCCTCCACCTGGACAGCCGGATACAAAGACTACGGTCCTTCAGCCGAC
GACTCCGGAACTGCCGCCGCCGCCGCCGCAGCAGCAGGAGCAGCAGCAGGAGCACCACCACCACCACCAACACCC
AAGGCGACCGCACCGCAACCCGAAGCCGCAACAGCCATGGAAGTGGAAAAGCCCACCCCAGCAGAAGAAGGCGAC
AAGAAGAAACGCAAGAAGCACGAGGGCGAAACCCCCGAGGAGAAAGCCGAGCGCAAACGCCGGAAAGCAGACAAG
AAGGCCGCAAAAGCAGCCAAGAAGTCGGCCACCAAGGACGACGCCGCGCCCGACGACGGAGACAGCGATTAA
Transcript >Ophcf2|05065
ATGGAGCTCGTCAAGAGAAAAGACGAAGAGTACGCCATCAAGCCGCAGGCCTTTACGCCCGCCCTCGATACGAGC
TCGTGGCCGCTGCTGCTCAAGAACTACGATAGACTTCTCATTCGGACGGGGCATTTTACACCCCTTGTCAATGGG
TGCTCGCCACTGAAACGCGATATCAAGTCGTACATCAGTTCCGGCGTGATCAATCTCGACAAGCCGTCTAACCCT
TCGAGCCACGAGGTCGTCGCCTGGGTCAAGCGCATCCTACGCGTCGAAAAGACGGGTCACAGCGGCACCCTCGAT
CCCAAGGTCACCGGCTGCCTCATCGTCTGCATCGACCGCGCCACCCGTCTCGTCAAATCGCAGCAAGGCGCGGGG
AAAGAATACGTCTGCGTCATTCGGCTGCACGACAAGGTCCCCGGCGGTGAAGCTCAGTTCGCGCGCGCGCTCGAG
ACTCTTACGGGCGCTCTGTTTCAGCGTCCGCCTCTCATCTCGGCTGTTAAGCGGCAGCTGCGTATCCGCACCATC
CACGAGAGCCGGCTCATCGAGTTCGATAATGATCGTCATCTTGGTGTCTTTTGGGTTAGCTGCGAGGCCGGCACT
TACATTCGGACTCTGTGCGTTCATCTTGGTCTTCTCCTTGGCGTCGGCGCCCACATGCAGGAGCTGCGTCGCGTT
CGTAGCGGTGCCATGGACGAGTCCAAGCAGCTCGTTACTCTGCACGATGTCCTGGATGCTCAGTGGATGATGGAT
AATACGCGCGACGAGTCATATCTCCGCAAGGTCATCTCACCTCTGGAGACGCTGTTGACGTCCTACAAGCGCCTT
GTGGTCAAGGACAGCGCCGTCAACGCCGTCTGCTACGGCGCCAAACTGATGCTACCAGGTCTCCTGCGCTACGAG
GCCGGCATCGAACACCATGACGAAGTCGTACTCATGACAACAAAAGGCGAGGCCATCGCCCTGGGAATCGCCCAC
ATGGCCACGGTCGAAATGTCAACCTGCGACCACGGCATCGTCGCAAGGGTCAAGCGCTGCATCATGGAACGAGAC
CTCTACCCAAGACGCTGGGGTCTAGGCCCCGTAGCCATGGAAAAGAAGAAGCTCAAAGCCGACGGCAAACTCGAC
AAACACGGCCGCCCCAACGACGCAACCCCCTCCACCTGGACAGCCGGATACAAAGACTACGGTCCTTCAGCCGAC
GACTCCGGAACTGCCGCCGCCGCCGCCGCAGCAGCAGGAGCAGCAGCAGGAGCACCACCACCACCACCAACACCC
AAGGCGACCGCACCGCAACCCGAAGCCGCAACAGCCATGGAAGTGGAAAAGCCCACCCCAGCAGAAGAAGGCGAC
AAGAAGAAACGCAAGAAGCACGAGGGCGAAACCCCCGAGGAGAAAGCCGAGCGCAAACGCCGGAAAGCAGACAAG
AAGGCCGCAAAAGCAGCCAAGAAGTCGGCCACCAAGGACGACGCCGCGCCCGACGACGGAGACAGCGATTAA
Gene >Ophcf2|05065
ATGGAGCTCGTCAAGAGAAAAGACGAAGAGTACGCCATCAAGCCGCAGGCCTTTACGCCCGCCCTCGATACGAGC
TCGTGGCCGCTGCTGCTCAAGAACTACGATAGACGTGCGTGCCCTCTTCGTTGTTGGATTTGCTGTGCTGATGGG
ATGTAGTTCTCATTCGGACGGGGCATTTTACACCCCTTGTCAATGGGTGCTCGCCACTGAAACGCGATATCAAGT
CGTACATCAGTTCCGGCGTGATCAATCTCGACAAGCCGTCTAACCCTTCGAGCCACGAGGTCGTCGCCTGGGTCA
AGCGCATCCTACGGTTCGTCCCTCTCTTCTTCTCCCTACTTTATATCACTCTTCTGACAGGATGTATGCAGCGTC
GAAAAGACGGGTCACAGCGGCACCCTCGATCCCAAGGTCACCGGCTGCCTCATCGTCTGCATCGACCGCGCCACC
CGTCTCGTCAAATCGCAGCAAGGCGCGGGGAAAGAATACGTCTGCGTCATTCGGCTGCACGACAAGGTCCCCGGC
GGTGAAGCTCAGTTCGCGCGCGCGCTCGAGACTCTTACGGGCGCTCTGTTTCAGCGTCCGCCTCTCATCTCGGCT
GTTAAGCGGCAGCTGCGTATCCGCACCATCCACGAGAGCCGGCTCATCGAGTTCGATAATGATCGTCATCTTGGT
GTCTTTTGGGTTAGCTGCGAGGCCGGCACTTACATTCGGACTCTGTGCGTTCATCTTGGTCTTCTCCTTGGCGTC
GGCGCCCACATGCAGGAGCTGCGTCGCGTTCGTAGCGGTGCCATGGACGAGTCCAAGCAGCTCGTTACTCTGCAC
GATGTCCTGGATGCTCAGTGGATGATGGATAATACGCGCGACGAGTCATATCTCCGCAAGGTCATCTCACCTCTG
GAGACGCTGTTGACGTCCTACAAGCGCCTTGTGGTCAAGGACAGCGCCGTCAACGCCGTCTGCTACGGCGCCAAA
CTGATGCTACCAGGTCTCCTGCGCTACGGTCCGTCTCCCTCACTCCCTCTCTCCCCATCTCTCGTCTCCCTTCTC
TTTCTAACTCGACGCAGAGGCCGGCATCGAACACCATGACGAAGTCGTACTCATGACAACAAAAGGCGAGGCCAT
CGCCCTGGGAATCGCCCACATGGCCACGGTCGAAATGTCAACCTGCGACCACGGCATCGTCGCAAGGGTCAAGCG
CTGCATCATGGAACGAGACCTCTACCCAAGACGCTGGGGTCTAGGCCCCGTAGCCATGGAAAAGAAGAAGCTCAA
AGCCGACGGCAAACTCGACAAACACGGCCGCCCCAACGACGCAACCCCCTCCACCTGGACAGCCGGATACAAAGA
CTACGGTCCTTCAGCCGACGACTCCGGAACTGCCGCCGCCGCCGCCGCAGCAGCAGGAGCAGCAGCAGGAGCACC
ACCACCACCACCAACACCCAAGGCGACCGCACCGCAACCCGAAGCCGCAACAGCCATGGAAGTGGAAAAGCCCAC
CCCAGCAGAAGAAGGCGACAAGAAGAAACGCAAGAAGCACGAGGGCGAAACCCCCGAGGAGAAAGCCGAGCGCAA
ACGCCGGAAAGCAGACAAGAAGGCCGCAAAAGCAGCCAAGAAGTCGGCCACCAAGGACGACGCCGCGCCCGACGA
CGGAGACAGCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail