Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05057
Gene name
Locationscaffold_05:2383544..2384210
Strand-
Gene length (bp)666
Transcript length (bp)603
Coding sequence length (bp)603
Protein length (aa) 201

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04900 Fcf1 Fcf1 5.3E-33 97 193
PF18477 PIN_9 PIN like domain 4.3E-10 74 176

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:1990904 ribonucleoprotein complex No
GO:0005575 cellular_component No
GO:0030684 preribosome No
GO:0032991 protein-containing complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2143 0.7219 0.0042 0.0802 0.3373 0.0623 0.0707 0.0109 0.0251 0.0002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2551
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7603
Ophiocordyceps australis map64 (Brazil) OphauB2|3636
Ophiocordyceps camponoti-floridani Ophcf2|05057 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3953
Ophiocordyceps kimflemingae Ophio5|4584
Ophiocordyceps subramaniannii Hirsu2|3778

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05057
MGVAKKTRKFGQVKRLLGKRDARLKANKEKLEQQVKDAAKTKKTASGELVRTVPQMPSNLFFQHNTALVPPYNVL
VDTNFLSHSVQRKLSLLESMMDCLYAKCNPIITSCVMAELEKLGPKYRLALRVARDERWQRLECDHKGVYADDCL
VDRVTKNRIYIVGTNDKALKQRLRKIPGVPLMSVARGKFVVERLPGAPES*
Coding >Ophcf2|05057
ATGGGCGTCGCCAAGAAAACCAGAAAGTTCGGGCAGGTCAAGCGACTCCTCGGGAAGCGCGACGCCAGACTCAAG
GCCAACAAGGAGAAATTAGAGCAGCAGGTAAAAGACGCAGCCAAGACCAAGAAGACGGCGAGCGGCGAGCTGGTA
CGGACGGTGCCGCAGATGCCGAGCAATCTCTTCTTCCAGCACAACACGGCGCTGGTGCCGCCCTACAACGTCCTC
GTCGACACAAACTTCCTCAGCCACAGCGTTCAGCGCAAGCTCTCGCTCCTCGAGTCCATGATGGATTGCCTCTAC
GCCAAGTGCAACCCCATCATCACCTCGTGCGTCATGGCTGAGCTCGAGAAGCTGGGGCCCAAGTATCGACTGGCG
CTGCGGGTTGCTCGTGATGAGCGGTGGCAGCGGCTGGAGTGTGATCACAAGGGTGTCTATGCGGATGACTGCCTC
GTCGATAGGGTGACGAAGAATCGCATCTATATTGTCGGCACCAACGATAAGGCGCTGAAGCAGCGGTTGCGCAAG
ATCCCTGGCGTGCCGCTTATGAGTGTGGCCCGTGGCAAGTTTGTGGTGGAGAGGCTGCCGGGCGCGCCCGAGTCA
TGA
Transcript >Ophcf2|05057
ATGGGCGTCGCCAAGAAAACCAGAAAGTTCGGGCAGGTCAAGCGACTCCTCGGGAAGCGCGACGCCAGACTCAAG
GCCAACAAGGAGAAATTAGAGCAGCAGGTAAAAGACGCAGCCAAGACCAAGAAGACGGCGAGCGGCGAGCTGGTA
CGGACGGTGCCGCAGATGCCGAGCAATCTCTTCTTCCAGCACAACACGGCGCTGGTGCCGCCCTACAACGTCCTC
GTCGACACAAACTTCCTCAGCCACAGCGTTCAGCGCAAGCTCTCGCTCCTCGAGTCCATGATGGATTGCCTCTAC
GCCAAGTGCAACCCCATCATCACCTCGTGCGTCATGGCTGAGCTCGAGAAGCTGGGGCCCAAGTATCGACTGGCG
CTGCGGGTTGCTCGTGATGAGCGGTGGCAGCGGCTGGAGTGTGATCACAAGGGTGTCTATGCGGATGACTGCCTC
GTCGATAGGGTGACGAAGAATCGCATCTATATTGTCGGCACCAACGATAAGGCGCTGAAGCAGCGGTTGCGCAAG
ATCCCTGGCGTGCCGCTTATGAGTGTGGCCCGTGGCAAGTTTGTGGTGGAGAGGCTGCCGGGCGCGCCCGAGTCA
TGA
Gene >Ophcf2|05057
ATGGGCGTCGCCAAGAAAACCAGAAAGTTCGGGCAGGTAAGAAGAAGACGTGTCTCGGATGAGACTCATGCGAAG
TACACAGCGGCTGACAATCACCAGGTCAAGCGACTCCTCGGGAAGCGCGACGCCAGACTCAAGGCCAACAAGGAG
AAATTAGAGCAGCAGGTAAAAGACGCAGCCAAGACCAAGAAGACGGCGAGCGGCGAGCTGGTACGGACGGTGCCG
CAGATGCCGAGCAATCTCTTCTTCCAGCACAACACGGCGCTGGTGCCGCCCTACAACGTCCTCGTCGACACAAAC
TTCCTCAGCCACAGCGTTCAGCGCAAGCTCTCGCTCCTCGAGTCCATGATGGATTGCCTCTACGCCAAGTGCAAC
CCCATCATCACCTCGTGCGTCATGGCTGAGCTCGAGAAGCTGGGGCCCAAGTATCGACTGGCGCTGCGGGTTGCT
CGTGATGAGCGGTGGCAGCGGCTGGAGTGTGATCACAAGGGTGTCTATGCGGATGACTGCCTCGTCGATAGGGTG
ACGAAGAATCGCATCTATATTGTCGGCACCAACGATAAGGCGCTGAAGCAGCGGTTGCGCAAGATCCCTGGCGTG
CCGCTTATGAGTGTGGCCCGTGGCAAGTTTGTGGTGGAGAGGCTGCCGGGCGCGCCCGAGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail