Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05053
Gene name
Locationscaffold_05:2374255..2375064
Strand-
Gene length (bp)809
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08058 NPCC Nuclear pore complex component 1.8E-22 11 135

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.1583 0.4225 0.0249 0.0486 0.1489 0.0172 0.6395 0.1346 0.1874 0.0121

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 38 55 17
2 68 90 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4802
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7598
Ophiocordyceps camponoti-floridani Ophcf2|05053 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7096
Ophiocordyceps kimflemingae Ophio5|6471
Ophiocordyceps subramaniannii Hirsu2|10399

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05053
MSPSPVPDSPGTWRHPRLNEITSRRNATTFNEKNVRRIACNLVAFLVLYAIRLVARLKFDPRILPATLLSYLGWA
WVAFQMVPLAQICLACLPLLRSNDDLSDIPLTATQRRLLGLPPSSAPPTPDGKFSTPPRYSRTPSIAGSVGSRAS
YNSSPLSGHASPAPQASTAASPSPFSSGGSPLLQKTMGGFAHGRRSSIGSTSPLGASTSANPFADASSPSPSAGK
RTSVGLNSKWLYEKGRRASGSAWLS*
Coding >Ophcf2|05053
ATGTCGCCGTCGCCCGTGCCCGACAGCCCCGGCACCTGGAGGCATCCGAGACTTAATGAGATCACGAGCAGACGC
AATGCCACGACCTTTAATGAGAAGAACGTGCGTCGTATAGCCTGCAATCTGGTAGCCTTTCTCGTTCTCTACGCC
ATCCGGCTCGTGGCTCGCCTCAAGTTCGATCCCCGCATCTTGCCCGCGACTCTCCTCTCTTACCTGGGCTGGGCC
TGGGTCGCCTTTCAGATGGTTCCTCTCGCACAGATCTGCCTCGCCTGCCTGCCACTCCTCCGCTCGAACGACGAT
CTATCCGACATACCCCTGACGGCCACACAGCGGCGACTGCTAGGCCTCCCCCCCTCATCGGCACCCCCAACACCC
GACGGAAAATTTAGCACTCCGCCTCGCTACTCGCGCACACCTTCCATCGCCGGCTCCGTCGGTAGCAGAGCCAGC
TACAATAGCTCACCGCTCTCAGGACACGCGAGTCCGGCACCGCAGGCCTCGACGGCGGCGTCCCCTTCTCCCTTC
TCCTCGGGCGGCAGTCCCCTTCTGCAGAAGACGATGGGCGGCTTCGCTCACGGCCGGAGGTCGTCCATAGGCTCG
ACCAGTCCTCTGGGCGCGAGCACTTCGGCCAATCCCTTTGCCGATGCCAGTTCGCCGAGTCCTTCGGCGGGGAAG
CGCACCAGCGTCGGGCTGAATAGCAAATGGCTCTACGAAAAGGGGCGTCGAGCTTCAGGAAGTGCCTGGCTTTCG
TGA
Transcript >Ophcf2|05053
ATGTCGCCGTCGCCCGTGCCCGACAGCCCCGGCACCTGGAGGCATCCGAGACTTAATGAGATCACGAGCAGACGC
AATGCCACGACCTTTAATGAGAAGAACGTGCGTCGTATAGCCTGCAATCTGGTAGCCTTTCTCGTTCTCTACGCC
ATCCGGCTCGTGGCTCGCCTCAAGTTCGATCCCCGCATCTTGCCCGCGACTCTCCTCTCTTACCTGGGCTGGGCC
TGGGTCGCCTTTCAGATGGTTCCTCTCGCACAGATCTGCCTCGCCTGCCTGCCACTCCTCCGCTCGAACGACGAT
CTATCCGACATACCCCTGACGGCCACACAGCGGCGACTGCTAGGCCTCCCCCCCTCATCGGCACCCCCAACACCC
GACGGAAAATTTAGCACTCCGCCTCGCTACTCGCGCACACCTTCCATCGCCGGCTCCGTCGGTAGCAGAGCCAGC
TACAATAGCTCACCGCTCTCAGGACACGCGAGTCCGGCACCGCAGGCCTCGACGGCGGCGTCCCCTTCTCCCTTC
TCCTCGGGCGGCAGTCCCCTTCTGCAGAAGACGATGGGCGGCTTCGCTCACGGCCGGAGGTCGTCCATAGGCTCG
ACCAGTCCTCTGGGCGCGAGCACTTCGGCCAATCCCTTTGCCGATGCCAGTTCGCCGAGTCCTTCGGCGGGGAAG
CGCACCAGCGTCGGGCTGAATAGCAAATGGCTCTACGAAAAGGGGCGTCGAGCTTCAGGAAGTGCCTGGCTTTCG
TGA
Gene >Ophcf2|05053
ATGTCGCCGTCGCCCGTGCCCGACAGCCCCGGCACCTGGAGGCATCCGAGACTTAATGAGATCACGAGCAGACGC
AATGCCACGACCTTTAATGAGAAGAACGTGCGTCGTATAGCCTGCAATCTGGTAGCCTTTCTCGTTCTCTACGCC
ATCCGGCTCGTGGCTCGCCTCAAGTTCGATCCCCGCATGTATGTCCACGCTTCATCCCCAAGTCTTTTAAACTCC
CGCTCATGGACGTCACCAGCTTGCCCGCGACTCTCCTCTCTTACCTGGGCTGGGCCTGGGTCGCCTTTCAGATGG
TTCCTCTCGCACAGATCTGCCTCGCCTGCCTGCCACTCCTCCGCTCGAACGACGATCTATCCGACATACCCCTGA
CGGCCACACAGCGGCGACTGCTAGGCCTCCCCCCCTCATCGGCACCCCCAACACCCGACGGAAAATTTAGCACTC
CGCCTCGCTACTCGCGCACACCTTCCATCGCCGGCTCCGTCGGTAGCAGAGCCAGCTACAATAGCTCACCGCTCT
CAGGACACGCGAGTCCGGCACCGCAGGCCTCGACGGCGGCGTCCCCTTCTCCCTTCTCCTCGGGCGGCAGTCCCC
TTCTGCAGAAGACGATGGGCGGCTTCGCTCACGGCCGGAGGTCGTCCATAGGCTCGACCAGTCCTCTGGGCGCGA
GCACTTCGGCCAATCCCTTTGCCGATGCCAGTTCGCCGAGTCCTTCGGCGGGGAAGCGCACCAGCGTCGGGCTGA
ATAGCAAATGGCTCTACGAAAAGGGGCGTCGAGCTTCAGGAAGTGCCTGGCTTTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail