Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05049
Gene name
Locationscaffold_05:2369261..2369902
Strand+
Gene length (bp)641
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05255 UPF0220 Uncharacterised protein family (UPF0220) 1.2E-64 3 165

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22
2 59 78 19
3 99 121 22
4 136 158 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 211.76 119.69 303.82
Alive In ants, during behavior modification 136.81 68.84 204.79
Dead In ants, recently dead 123.42 65.57 181.26

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.033671 yes
Alive Dead 0.634782 no
Dead Fungus 0.003275 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05049
MDNHRLWKFGRPDWLNSAWARSAGIYAAGALFSVAFYVMLDSAVWSKSALNGSNVHIRFVDWLPLIFSSLGMLII
NSIEKQRLSADSFSYSGSGVAWKARVVLFLGFAALAGGMAGGVTVFVLKFIVPGVSMPALGMGIENIISNALVGI
SSVVLWVSQNMEDEYSYNLAI*
Coding >Ophcf2|05049
ATGGACAACCACCGACTCTGGAAGTTTGGGAGGCCGGACTGGCTTAATAGCGCTTGGGCTCGCAGCGCGGGCATC
TACGCTGCCGGTGCCCTCTTCTCTGTCGCCTTTTACGTCATGCTCGATTCGGCTGTCTGGTCCAAGTCGGCTCTC
AACGGTTCCAACGTCCATATCCGCTTCGTCGATTGGCTGCCCCTCATCTTCTCCAGCCTCGGCATGCTCATCATC
AACTCCATCGAGAAGCAGCGCCTCAGCGCAGACTCCTTCAGTTATAGTGGCTCTGGAGTCGCCTGGAAGGCCCGC
GTCGTCCTATTTCTCGGCTTTGCTGCTTTGGCCGGTGGCATGGCCGGCGGCGTCACCGTCTTTGTCCTCAAGTTC
ATCGTCCCCGGCGTTTCCATGCCAGCCCTCGGCATGGGCATCGAGAATATCATAAGCAACGCCCTCGTCGGCATC
AGCTCCGTTGTTCTTTGGGTCAGTCAGAATATGGAAGACGAGTACTCGTACAATCTGGCGATATGA
Transcript >Ophcf2|05049
ATGGACAACCACCGACTCTGGAAGTTTGGGAGGCCGGACTGGCTTAATAGCGCTTGGGCTCGCAGCGCGGGCATC
TACGCTGCCGGTGCCCTCTTCTCTGTCGCCTTTTACGTCATGCTCGATTCGGCTGTCTGGTCCAAGTCGGCTCTC
AACGGTTCCAACGTCCATATCCGCTTCGTCGATTGGCTGCCCCTCATCTTCTCCAGCCTCGGCATGCTCATCATC
AACTCCATCGAGAAGCAGCGCCTCAGCGCAGACTCCTTCAGTTATAGTGGCTCTGGAGTCGCCTGGAAGGCCCGC
GTCGTCCTATTTCTCGGCTTTGCTGCTTTGGCCGGTGGCATGGCCGGCGGCGTCACCGTCTTTGTCCTCAAGTTC
ATCGTCCCCGGCGTTTCCATGCCAGCCCTCGGCATGGGCATCGAGAATATCATAAGCAACGCCCTCGTCGGCATC
AGCTCCGTTGTTCTTTGGGTCAGTCAGAATATGGAAGACGAGTACTCGTACAATCTGGCGATATGA
Gene >Ophcf2|05049
ATGGACAACCACCGACTCTGGAAGTTTGGGAGGCCGGACTGGCTTAATAGCGCTTGGGCTCGCAGCGCGGGCATC
TACGCTGCCGGTGCCCTCGTACGTTGATACTAACCCCGTCGTCTTCTAACTCCTGCGACACTGACCACGTTTGAC
GCAGTTCTCTGTCGCCTTTTACGTCATGCTCGATTCGGCTGTCTGGTCCAAGTCGGCTCTCAACGGTTCCAACGT
CCATATCCGCTTCGTCGATTGGCTGCCCCTCATCTTCTCCAGCCTCGGCATGCTCATCATCAACTCCATCGAGAA
GCAGCGCCTCAGCGCAGACTCCTTCAGTTATAGTGGCTCTGGAGTCGCCTGGAAGGCCCGCGTCGTCCTATTTCT
CGGCTTTGCTGCTTTGGCCGGTGGCATGGCCGGCGGCGTCACCGTCTTTGTCCTCAAGTTCATCGTCCCCGGCGT
TTCCATGCCAGCCCTCGGCATGGGCATCGAGAATATCATAAGCAACGCCCTCGTCGGCATCAGGTATATACTTAC
TTGCTCTTTTCCCTCTTGTCCCGGTTTCAGCTGCTCACGGACCTTGTTCAAGCTCCGTTGTTCTTTGGGTCAGTC
AGAATATGGAAGACGAGTACTCGTACAATCTGGCGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail