Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05042
Gene name
Locationscaffold_05:2352127..2352877
Strand+
Gene length (bp)750
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00025 Arf ADP-ribosylation factor family 7.3E-74 8 176
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 4.7E-14 19 129
PF09439 SRPRB Signal recognition particle receptor beta subunit 4.2E-13 17 144
PF00071 Ras Ras family 5.3E-11 19 178
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 6.9E-08 19 130
PF01926 MMR_HSR1 50S ribosome-binding GTPase 3.8E-06 19 126

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus 0.4511 0.1127 0.075 0.4859 0.3185 0.1158 0.2223 0.4665 0.7709 0.2121

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5678
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5150
Ophiocordyceps australis map64 (Brazil) OphauB2|6189
Ophiocordyceps camponoti-floridani Ophcf2|05042 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1081
Ophiocordyceps kimflemingae Ophio5|2852
Ophiocordyceps subramaniannii Hirsu2|8337

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05042
MGASVSWLSGLLWTKKEIRILILGLDNAGKTTILYRLKIGEVVTTIPTIGFNVESVSYQNLNFNVWDLGGQTSIR
PYWRCYYANTAAVIFVVDSTDIDRLQTAAEELAAMLNEEELKDASLLVFANKQDQPGAKGAGEISEALRLGELRD
RNWSIMACSAVDGSGVNEGMDWLVQTVSQE*
Coding >Ophcf2|05042
ATGGGCGCGAGCGTGTCGTGGCTTTCTGGCCTGCTTTGGACGAAGAAGGAGATTCGAATTTTGATACTTGGGCTT
GATAATGCGGGTAAAACGACGATCCTTTACAGGCTAAAGATCGGTGAGGTGGTGACGACGATACCGACTATTGGC
TTCAACGTCGAGTCCGTCTCGTACCAGAATCTCAACTTCAACGTCTGGGATCTCGGCGGTCAAACCAGCATCCGC
CCTTACTGGCGGTGCTACTACGCTAACACCGCCGCCGTCATCTTCGTCGTCGACTCCACCGACATCGACCGCCTG
CAGACAGCAGCCGAGGAGCTAGCCGCCATGCTCAACGAAGAGGAGCTCAAGGACGCTTCCCTCCTCGTCTTCGCC
AATAAGCAGGATCAACCTGGCGCCAAAGGTGCCGGCGAGATTTCCGAGGCCTTGAGATTGGGCGAGCTGCGCGAT
CGGAATTGGAGTATTATGGCTTGCTCGGCTGTTGATGGCAGCGGTGTCAATGAGGGCATGGACTGGCTCGTTCAA
ACCGTGTCGCAAGAGTAA
Transcript >Ophcf2|05042
ATGGGCGCGAGCGTGTCGTGGCTTTCTGGCCTGCTTTGGACGAAGAAGGAGATTCGAATTTTGATACTTGGGCTT
GATAATGCGGGTAAAACGACGATCCTTTACAGGCTAAAGATCGGTGAGGTGGTGACGACGATACCGACTATTGGC
TTCAACGTCGAGTCCGTCTCGTACCAGAATCTCAACTTCAACGTCTGGGATCTCGGCGGTCAAACCAGCATCCGC
CCTTACTGGCGGTGCTACTACGCTAACACCGCCGCCGTCATCTTCGTCGTCGACTCCACCGACATCGACCGCCTG
CAGACAGCAGCCGAGGAGCTAGCCGCCATGCTCAACGAAGAGGAGCTCAAGGACGCTTCCCTCCTCGTCTTCGCC
AATAAGCAGGATCAACCTGGCGCCAAAGGTGCCGGCGAGATTTCCGAGGCCTTGAGATTGGGCGAGCTGCGCGAT
CGGAATTGGAGTATTATGGCTTGCTCGGCTGTTGATGGCAGCGGTGTCAATGAGGGCATGGACTGGCTCGTTCAA
ACCGTGTCGCAAGAGTAA
Gene >Ophcf2|05042
ATGGGCGCGAGCGTGTCGTGGCTTTCTGGCCTGCTTTGGACGAAGAAGGAGATTCGAATTTTGATACTTGGGCTT
GTGAGTTGATTGCATCGTTGGATGGGTTGGGGCTGACTTGAGGTAGGATAATGCGGGTAAAACGACGATCCTTTA
CAGGCTAAAGGTGAGATACCGATCTTTTCTCTTCTGACGGGTTTTGCTGATGAGATTTCATTCAGATCGGTGAGG
TGGTGACGACGATACCGACTATTGGCTTCAACGTCGAGTCCGTCTCGTACCAGAATCTCAACTTCAACGTCTGGG
TAAGACGATATTCCCCCCCCCTCAACTTCTCCAACACTTAACACCCAATAGGATCTCGGCGGTCAAACCAGCATC
CGCCCTTACTGGCGGTGCTACTACGCTAACACCGCCGCCGTCATCTTCGTCGTCGACTCCACCGACATCGACCGC
CTGCAGACAGCAGCCGAGGAGCTAGCCGCCATGCTCAACGAAGAGGAGCTCAAGGACGCTTCCCTCCTCGTCTTC
GCCAATAAGCAGGATCAACCTGGCGCCAAAGGTGCCGGCGAGATTTCCGAGGCCTTGAGATTGGGCGAGCTGCGC
GATCGGAATTGGAGTATTATGGCTTGCTCGGCTGTTGATGGCAGCGGTGTCAATGAGGGCATGGACTGGCTCGTT
GTGAGTTTTGACCCGTCATGGATTGGTCGGTTGCTGTGCTGATGACTTTCTTAGCAAACCGTGTCGCAAGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail