Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05040
Gene name
Locationscaffold_05:2346181..2347922
Strand-
Gene length (bp)1741
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 1.9E-60 5 396

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 89 111 22
3 168 190 22
4 210 229 19
5 342 364 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05040
MWRRTYLLLVCVRLWFALSTSYLHPDENFQGPEIVAGEIFSYPIRRTWEFTSDHPIRSVFPLWPVYGLPMLLLRW
LWIGNGQDGEIPPIVVFWTLRVLMFLISFVLEDWALHELIPSPRHRRVAVLLVASSYVTWTYQTHTFSNSIETLV
VAWSLVLIQRIVDSRHKSSLLSSAVLGLVAVFGIFNRITFPAFLLIPSLRLIPHLLNNPLSLAALTVVALVTTAV
AIALDTSFYSSEPITWAQLVAKPVITPLNNFLYNSSAENLAQHGLHPWYQHLLANLPQLLGPAAILLFTQPHLSI
RLYSAVSGLAVLSMFQHQEARFLLPTVPLMLSSIRLPRNQTVLRIWVASWVAFNILMGVLMGTYHQGGIIPGQVF
MSKQPDATQAIWWKTYSPPIWLLDGKNQVLQTRDVMGLAGDALLDQLASLATCDAPAYRRNQEYPKERNGTYLIA
PASATWLDQHLHDRDARGLRFREVWRHRMHLNLDDLEFDNGVWKTLSRVVGQRGLVIFRVTVGCQGGGGVRALTE
*
Coding >Ophcf2|05040
ATGTGGCGTCGCACATATCTCCTCCTCGTCTGTGTCCGCTTGTGGTTCGCCCTGTCAACCAGCTATCTTCATCCC
GACGAGAACTTTCAGGGCCCCGAGATAGTCGCAGGTGAAATCTTTAGCTACCCCATCCGTCGCACCTGGGAGTTC
ACGAGCGACCATCCGATTCGAAGCGTCTTCCCACTATGGCCCGTCTACGGCCTGCCGATGCTGCTCCTGCGATGG
CTCTGGATCGGCAACGGCCAGGATGGCGAAATCCCTCCCATCGTCGTCTTCTGGACCCTTCGCGTCCTCATGTTC
CTCATCAGCTTCGTCCTCGAAGACTGGGCCCTACATGAGTTGATACCCTCGCCCAGGCACCGTCGCGTCGCCGTC
CTGCTGGTCGCCTCGTCCTACGTCACCTGGACCTACCAGACGCACACCTTTTCCAATTCCATCGAGACTCTGGTC
GTCGCCTGGAGCCTGGTTCTTATCCAGCGCATCGTCGATTCGCGTCATAAATCGTCGCTCCTGTCCTCGGCAGTC
CTCGGTCTCGTAGCCGTCTTCGGCATCTTTAATCGCATCACTTTTCCCGCTTTCCTCTTGATTCCCAGTCTTCGT
TTGATACCCCATCTGTTGAATAATCCTCTGTCTCTCGCCGCCCTAACCGTCGTCGCTCTCGTCACCACAGCCGTC
GCCATCGCACTCGATACCTCCTTCTACTCGTCCGAGCCCATCACCTGGGCCCAGCTCGTCGCCAAGCCCGTCATC
ACGCCTCTCAACAACTTCCTCTACAATTCCTCCGCCGAGAACCTCGCCCAGCATGGCCTGCACCCCTGGTATCAG
CACCTCCTGGCCAACCTCCCGCAGCTGCTGGGTCCCGCCGCCATCTTGCTCTTCACCCAACCGCACCTCTCCATC
CGACTCTACTCGGCCGTCTCGGGCCTGGCCGTACTGTCCATGTTCCAGCACCAAGAGGCCCGCTTCCTCCTACCG
ACCGTCCCCCTGATGCTCTCCTCGATCCGGCTGCCGAGGAACCAAACCGTCCTCCGGATCTGGGTCGCGTCTTGG
GTGGCCTTTAATATTCTGATGGGCGTCTTGATGGGCACCTACCACCAGGGCGGCATCATCCCCGGCCAGGTCTTC
ATGAGCAAGCAGCCCGACGCGACGCAGGCCATATGGTGGAAGACGTACTCGCCCCCCATCTGGCTCCTCGACGGC
AAGAACCAGGTGCTACAAACGCGCGACGTCATGGGCCTCGCCGGCGACGCCCTGCTCGACCAGCTCGCCTCGCTG
GCGACATGCGACGCGCCCGCCTACCGCCGGAACCAAGAATACCCCAAGGAGAGGAACGGCACGTACCTCATCGCC
CCTGCCTCGGCCACCTGGCTGGACCAGCACCTGCACGACCGCGACGCGAGGGGCCTGCGCTTCCGCGAGGTCTGG
CGCCATCGGATGCATCTCAACCTCGACGACTTGGAGTTCGATAACGGCGTGTGGAAGACGCTGTCTAGGGTTGTT
GGCCAGCGGGGACTGGTCATCTTTAGGGTTACCGTTGGATGTCAGGGTGGTGGTGGTGTTCGCGCGTTGACGGAG
TAG
Transcript >Ophcf2|05040
ATGTGGCGTCGCACATATCTCCTCCTCGTCTGTGTCCGCTTGTGGTTCGCCCTGTCAACCAGCTATCTTCATCCC
GACGAGAACTTTCAGGGCCCCGAGATAGTCGCAGGTGAAATCTTTAGCTACCCCATCCGTCGCACCTGGGAGTTC
ACGAGCGACCATCCGATTCGAAGCGTCTTCCCACTATGGCCCGTCTACGGCCTGCCGATGCTGCTCCTGCGATGG
CTCTGGATCGGCAACGGCCAGGATGGCGAAATCCCTCCCATCGTCGTCTTCTGGACCCTTCGCGTCCTCATGTTC
CTCATCAGCTTCGTCCTCGAAGACTGGGCCCTACATGAGTTGATACCCTCGCCCAGGCACCGTCGCGTCGCCGTC
CTGCTGGTCGCCTCGTCCTACGTCACCTGGACCTACCAGACGCACACCTTTTCCAATTCCATCGAGACTCTGGTC
GTCGCCTGGAGCCTGGTTCTTATCCAGCGCATCGTCGATTCGCGTCATAAATCGTCGCTCCTGTCCTCGGCAGTC
CTCGGTCTCGTAGCCGTCTTCGGCATCTTTAATCGCATCACTTTTCCCGCTTTCCTCTTGATTCCCAGTCTTCGT
TTGATACCCCATCTGTTGAATAATCCTCTGTCTCTCGCCGCCCTAACCGTCGTCGCTCTCGTCACCACAGCCGTC
GCCATCGCACTCGATACCTCCTTCTACTCGTCCGAGCCCATCACCTGGGCCCAGCTCGTCGCCAAGCCCGTCATC
ACGCCTCTCAACAACTTCCTCTACAATTCCTCCGCCGAGAACCTCGCCCAGCATGGCCTGCACCCCTGGTATCAG
CACCTCCTGGCCAACCTCCCGCAGCTGCTGGGTCCCGCCGCCATCTTGCTCTTCACCCAACCGCACCTCTCCATC
CGACTCTACTCGGCCGTCTCGGGCCTGGCCGTACTGTCCATGTTCCAGCACCAAGAGGCCCGCTTCCTCCTACCG
ACCGTCCCCCTGATGCTCTCCTCGATCCGGCTGCCGAGGAACCAAACCGTCCTCCGGATCTGGGTCGCGTCTTGG
GTGGCCTTTAATATTCTGATGGGCGTCTTGATGGGCACCTACCACCAGGGCGGCATCATCCCCGGCCAGGTCTTC
ATGAGCAAGCAGCCCGACGCGACGCAGGCCATATGGTGGAAGACGTACTCGCCCCCCATCTGGCTCCTCGACGGC
AAGAACCAGGTGCTACAAACGCGCGACGTCATGGGCCTCGCCGGCGACGCCCTGCTCGACCAGCTCGCCTCGCTG
GCGACATGCGACGCGCCCGCCTACCGCCGGAACCAAGAATACCCCAAGGAGAGGAACGGCACGTACCTCATCGCC
CCTGCCTCGGCCACCTGGCTGGACCAGCACCTGCACGACCGCGACGCGAGGGGCCTGCGCTTCCGCGAGGTCTGG
CGCCATCGGATGCATCTCAACCTCGACGACTTGGAGTTCGATAACGGCGTGTGGAAGACGCTGTCTAGGGTTGTT
GGCCAGCGGGGACTGGTCATCTTTAGGGTTACCGTTGGATGTCAGGGTGGTGGTGGTGTTCGCGCGTTGACGGAG
TAG
Gene >Ophcf2|05040
ATGTGGCGTCGCACATATCTCCTCCTCGTCTGTGTCCGCTTGTGGTTCGCCCTGTCAACCAGCTATCTTCATCCC
GACGAGAACTTTCAGGGCCCCGAGATAGTCGCAGGTAACGCCCATCGCTTCCTTCATTCATCTCACCCCTGCTGA
CGCCACCGGCCTCAAGGTGAAATCTTTAGCTACCCCATCCGTCGCACCTGGGAGTTCACGAGCGACCATCCGATT
CGAAGCGTCTTCCCACTATGGCCCGTCTACGGCCTGCCGATGCTGCTCCTGCGATGGCTCTGGATCGGCAACGGC
CAGGATGGCGAAATCCCTCCCATCGTCGTCTTCTGGACCCTTCGCGTCCTCATGTTCCTCATCAGCTTCGTCCTC
GAAGACTGGGCCCTACATGAGTTGATACCCTCGCCCAGGCACCGTCGCGTCGCCGTCCTGCTGGTCGCCTCGTCC
TACGTCACCTGGACCTACCAGACGCACACCTTTTCCAATTCCATCGAGACTCTGGTCGTCGCCTGGAGCCTGGTT
CTTATCCAGCGCATCGTCGATTCGCGTGTATGTCTCGTCCGTCTCAGTCCTGTTCCCTGAACCTGAAGCTGACGT
GTCTTCTGCCAGCATAAATCGTCGCTCCTGTCCTCGGCAGTCCTCGGTCTCGTAGCCGTCTTCGGCATCTTTAAT
CGCATCACTTTTCCCGCTTTCCTCTTGATTCCCAGTCTTCGTTTGATACCCCATCTGTTGAATAAGTGAGTCTTC
TTCTCGTCTTGATCTGTCCGCGTCTAACCTGTACAGTCCTCTGTCTCTCGCCGCCCTAACCGTCGTCGCTCTCGT
CACCACAGCCGTCGCCATCGCACTCGATACCTCCTTCTACTCGTCCGAGCCCATCACCTGGGCCCAGCTCGTCGC
CAAGCCCGTCATCACGCCTCTCAACAACTTCCTCTACAATTCCTCCGCCGAGAACCTCGCCCAGCATGGCCTGCA
CCCCTGGTATCAGCACCTCCTGGCCAACCTCCCGCAGCTGCTGGGTCCCGCCGCCATCTTGCTCTTCACCCAACC
GCACCTCTCCATCCGACTCTACTCGGCCGTCTCGGGCCTGGCCGTACTGTCCATGTTCCAGCACCAAGAGGCCCG
CTTCCTCCTACCGACCGTCCCCCTGATGCTCTCCTCGATCCGGCTGCCGAGGAACCAAACCGTCCTCCGGATCTG
GGTCGCGTCTTGGGTGGCCTTTAATATTCTGATGGGCGTCTTGATGGGCACCTACCACCAGGGCGGCATCATCCC
CGGCCAGGTCTTCATGAGCAAGCAGCCCGACGCGACGCAGGCCATATGGTGGAAGACGTACTCGCCCCCCATCTG
GCTCCTCGACGGCAAGAACCAGGTGCTACAAACGCGCGACGTCATGGGCCTCGCCGGCGACGCCCTGCTCGACCA
GCTCGCCTCGCTGGCGACATGCGACGCGCCCGCCTACCGCCGGAACCAAGAATACCCCAAGGAGAGGAACGGCAC
GTACCTCATCGCCCCTGCCTCGGCCACCTGGCTGGACCAGCACCTGCACGACCGCGACGCGAGGGGCCTGCGCTT
CCGCGAGGTCTGGCGCCATCGGATGCATCTCAACCTCGACGACTTGGAGTTCGATAACGGCGTGTGGAAGACGCT
GTCTAGGGTTGTTGGCCAGCGGGGACTGGTCATCTTTAGGGTTACCGTTGGATGTCAGGGTGGTGGTGGTGTTCG
CGCGTTGACGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail