Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05039
Gene name
Locationscaffold_05:2344980..2345867
Strand+
Gene length (bp)887
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family 5.1E-39 20 212

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5636 0.3409 0.1044 0.1196 0.2653 0.0054 0.0824 0.1555 0.081 0.0032

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5649
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5153
Ophiocordyceps australis map64 (Brazil) OphauB2|6192
Ophiocordyceps camponoti-floridani Ophcf2|05039 (this protein)
Ophiocordyceps kimflemingae Ophio5|2855
Ophiocordyceps subramaniannii Hirsu2|801

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05039
MSKITVAHVRTQIDELLEYSNNVKKRNFTETVELQCHLKNYDTSRDKRFNGSVKLPAPCRPGMSICILGDQHDLD
RAKHAGVDAMSVDDLKKLNKNKKLIKKLAGKYGAFLASEALIKQIPRVLGPGLSRANKFPVPISHNEELSVRIND
VRSLCKFQLKKALTLGVAIGTVQMGKEELLGNCMMAINYLVSLLKKGWLNLDTIVIKATMSPPKRLL*
Coding >Ophcf2|05039
ATGTCGAAAATCACCGTCGCACACGTCCGCACGCAGATTGACGAACTGCTCGAATACTCCAACAACGTCAAGAAG
CGCAACTTTACCGAAACGGTCGAGCTGCAATGCCATCTCAAGAACTACGACACCTCGCGCGATAAGCGTTTCAAC
GGCAGTGTCAAGCTTCCTGCTCCGTGTCGTCCGGGGATGAGCATCTGTATCCTTGGAGATCAGCATGATTTGGAT
AGGGCTAAACACGCCGGTGTGGACGCCATGTCCGTCGATGACCTCAAGAAACTCAACAAGAACAAGAAGCTCATC
AAGAAGCTCGCCGGCAAGTACGGCGCCTTCCTTGCTTCCGAGGCTCTCATCAAGCAAATCCCCCGTGTTCTTGGT
CCCGGTCTCTCAAGAGCCAACAAGTTCCCCGTCCCCATCTCGCACAACGAAGAACTCAGCGTCCGCATCAACGAC
GTCCGCTCCCTTTGCAAGTTCCAGCTTAAAAAGGCTCTTACCCTTGGCGTTGCCATCGGTACCGTTCAGATGGGC
AAGGAGGAGCTTCTCGGCAACTGCATGATGGCCATCAACTATCTCGTCAGCTTGCTCAAGAAGGGCTGGCTCAAC
CTCGACACCATTGTCATCAAGGCTACCATGTCGCCCCCTAAGCGCCTGCTCTAG
Transcript >Ophcf2|05039
ATGTCGAAAATCACCGTCGCACACGTCCGCACGCAGATTGACGAACTGCTCGAATACTCCAACAACGTCAAGAAG
CGCAACTTTACCGAAACGGTCGAGCTGCAATGCCATCTCAAGAACTACGACACCTCGCGCGATAAGCGTTTCAAC
GGCAGTGTCAAGCTTCCTGCTCCGTGTCGTCCGGGGATGAGCATCTGTATCCTTGGAGATCAGCATGATTTGGAT
AGGGCTAAACACGCCGGTGTGGACGCCATGTCCGTCGATGACCTCAAGAAACTCAACAAGAACAAGAAGCTCATC
AAGAAGCTCGCCGGCAAGTACGGCGCCTTCCTTGCTTCCGAGGCTCTCATCAAGCAAATCCCCCGTGTTCTTGGT
CCCGGTCTCTCAAGAGCCAACAAGTTCCCCGTCCCCATCTCGCACAACGAAGAACTCAGCGTCCGCATCAACGAC
GTCCGCTCCCTTTGCAAGTTCCAGCTTAAAAAGGCTCTTACCCTTGGCGTTGCCATCGGTACCGTTCAGATGGGC
AAGGAGGAGCTTCTCGGCAACTGCATGATGGCCATCAACTATCTCGTCAGCTTGCTCAAGAAGGGCTGGCTCAAC
CTCGACACCATTGTCATCAAGGCTACCATGTCGCCCCCTAAGCGCCTGCTCTAG
Gene >Ophcf2|05039
ATGTCGAAAATCACCGTCGGTACGTCCCCCCCCCCTTCCGTCCCCAACTCTCGAAGAATATAACCCCGCGTACCA
ACGACGATGAACCCAAAGCACACGTCCGCACGCAGATTGACGAACTGCTCGAATACTCCAACAACGTCAAGAAGC
GCAACTTTACCGAAACGGTCGAGCTGCAATGCCATCTCAAGAACTACGACACCTCGCGCGATAAGCGTTTCAACG
GCAGTGTCAAGCTTCCTGCTCCGTGTCGTCCGGGGATGAGCATCTGGTTCGCGCTCCTCTTTTGACGAAGCTTCG
TGGGAATGTTGGTGGCTGATTTCTTGCTTTCTTTCTTTTTTTTTTTTTCGGTGCGCGGGGGGGTTAGTATCCTTG
GAGATCAGCATGATTTGGATAGGGCTAAACACGCCGGTGTGGACGCCATGTCCGTCGATGACCTCAAGAAACTCA
ACAAGAACAAGAAGCTCATCAAGAAGCTCGCCGGCAAGTACGGCGCCTTCCTTGCTTCCGAGGCTCTCATCAAGC
AAATCCCCCGTGTTCTTGGTCCCGGTCTCTCAAGAGGTTCGTCCGCCTCCCCTTTACTTACTCTCCAATCCGTGA
GACGCAGCTTACCCCCCCCCGAAGCCAACAAGTTCCCCGTCCCCATCTCGCACAACGAAGAACTCAGCGTCCGCA
TCAACGACGTCCGCTCCCTTTGCAAGTTCCAGCTTAAAAAGGCTCTTACCCTTGGCGTTGCCATCGGTACCGTTC
AGATGGGCAAGGAGGAGCTTCTCGGCAACTGCATGATGGCCATCAACTATCTCGTCAGCTTGCTCAAGAAGGGCT
GGCTCAACCTCGACACCATTGTCATCAAGGCTACCATGTCGCCCCCTAAGCGCCTGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail