Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05034
Gene name
Locationscaffold_05:2316131..2325263
Strand+
Gene length (bp)9132
Transcript length (bp)7815
Coding sequence length (bp)7815
Protein length (aa) 2605

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16187 Peptidase_M16_M Middle or third domain of peptidase_M16 2.0E-96 407 694
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.0E-74 1622 2425
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 6.5E-18 221 400
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 4.5E-12 700 881
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 2.4E-30 46 195
PF06337 DUSP DUSP domain 2.0E-08 1308 1401

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0044238 primary metabolic process No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0070646 protein modification by small protein removal No
GO:0003824 catalytic activity No
GO:0008234 cysteine-type peptidase activity No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0043412 macromolecule modification No
GO:0101005 deubiquitinase activity No
GO:0008150 biological_process No
GO:0006508 proteolysis No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7232 0.5797 0.0496 0.0741 0.1005 0.0621 0.3716 0.0464 0.265 0.023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 59.19 28.21 90.17
Alive In ants, during behavior modification 74.11 33.57 114.65
Dead In ants, recently dead 58.50 27.99 89.01

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.371360 no
Alive Dead 0.262590 no
Dead Fungus 0.970104 no

Orthologs

Orthofinder run ID4
Orthogroup258
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6289
Ophiocordyceps australis 1348a (Ghana) OphauG2|6290
Ophiocordyceps australis map64 (Brazil) OphauB2|4366
Ophiocordyceps australis map64 (Brazil) OphauB2|4367
Ophiocordyceps camponoti-floridani Ophcf2|05034 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4211
Ophiocordyceps camponoti-rufipedis Ophun1|4212
Ophiocordyceps kimflemingae Ophio5|2102
Ophiocordyceps kimflemingae Ophio5|2103
Ophiocordyceps subramaniannii Hirsu2|1017
Ophiocordyceps subramaniannii Hirsu2|1018

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05034
MPSPQSPGLAPGRRTPVVVLADCLEKPSLDERDYRVVRLENELEALLVHDAETDKASAALDVNVGNFSDEEGMPG
MAHAVEHLLFMGTKKFPVENEYNQYLAANSGASNAYTASTSTNYFFDVAAKPANDENPSDSNPSPLHGALDRFAQ
FFVEPLFLPSTLDRELKAVDSENKKNLQNDTWRLHQLGKSLSNPKHPFCHFSTGNLNVLKTQPEAKGVNVRDKFI
EFHDKHYSANRMKLVVLGREPLDVLQKWVVELFSPIVNKKLPPNRWSDEVPFRDCDLAMQCFAKPVMDTRQLELT
FPFVDEEALFESQPSRYISHLIGHEGPGSIMSYVKNKGWVNGLSAWASSVCPGTPGMFEVQIRLTEEGLKNYPEI
VKIFFQYVSLLREASPQEWIFDEQKGMADVDFKFRQKTPASRFTSRTSSVMQKPLPREWLLSGNSRLRTFDAKLI
ENALSTIRPDKLRLMVVSRTFPGDWNAKEKWYGTEYRCEKIPDDLMAELNRAMEMSASERLPELHLPHKNNFIPS
KLEVDKKEVAEPAPAPRVLRNDALARTWWKKDDTFWVPKANVMVSLKNPIIHATAENSVKARIFTELVRDEFEEY
SYDAELAGLQYTVSLDLRGLFLDISGYNDKLPLLLKQVVVTIRDLDIRTERFDIVKERLTRGYKNFQLQSSYQQI
GDYVSWLNAERDYVVEELEAELKGITVDAVRLFHRQMLAQLYVEIYAHGNLYRDEALMVTDMVVSTFKARALPRW
QCPIIRSLTLPPGSNFVFNKTLEDPANVNHCVETWLSVGDRADGLARAKTLLIDQMTHEPAFDQLRTKEQLGYIV
FSGIRNFATTCGFRILIQSEKTPEYLEKRIEAFMAQFGTMLVTMSEAEFEGHKRSLIIRRLEKLRSLDQESSRHW
TQISNEYYDFEQAQVDAANIKPLTKADMVDFYNDYLSPSSSRRARLSVHLHARGAGELDLKVMDLLRTSGLDEVP
QAKRSCLALLDGHLKDVVKVPTEKREVIIRQAKELGLDVTAQSAEYDGEESGQLAAGPAQEITDVRRHRAALPAS
RGARPAKELSEFEDTDANHRRPFASRPSELPGQLTVKTPSSKKRKLARPPSNNSSSLSPDTALPSCEADDDPAFS
VASGLNTPLYARADSLPASSLPPRLQTQATSLVSAEYAASVASSSPCASVCADLSLDSDRGGEEAGSALSLTRSQ
SPLRWSRRAIMNGDDELPRRSSSPLKRRASGMEDSASDAGNRSSAADGDVNSSGRHNRAMSVDAPEANGHGSAQG
LSHPSPPLLEQIKIIETLLKASNDSPLIKDNAAYLVSRSWLNQALALRSDPKSSGGSGPADASLGPVDNSDIIGE
TIVDSNGKTFVRLKPGLGLESFELFSADAWKLVMDWYGLQQGQHPIIRFAVNTAENQHDPPNIMYEFHPPVFRVH
RLWSQVSPLPIEQSLKERNPPPLIVATSFTTISQSFLRSLKTLADIPMDRKVRLWSVSVPVVGGQAEPQATLTPP
DSPTSQSGQSWHNLLVDLPSFSRAVKTRIDMADQTANDKFNGSAPLKYFLNPPDDTLVIEEAVNGSWVSTYISDK
ADKSIPSQINMAVVSSKLSSSRSSPTEGMLTRGRAQKKRMGRMDGAVGLHNLGNTCYMNSALQCVRSVEELSKYF
LTESHLPEINEANVLGFQGKLAMAYGNLLREIYEEGRNAVSPRDFKATVGRCRPTFSGWGQQDSQEFLGFLLDAL
QEDLSRVKKKPYIAKPDSTDDMINNPEAIRRMAAEVWDITRRRDDSVIADLFTGMYKSTLKCPECGKISITFDPF
YNLTLPLPAESMWTRPVKFYPLHDAPVMLDVELPQHSSMESLKKFVSARTGVPTNRMMGAEEFRDRFFKIYDDNQ
YVSEEVTAQDIPTLHEVEAPPTNWPGKAPRKKFRSMLDVDMPLHAGEFDEEMSQVMAVPVLHRRPQCPGGRLDGG
VPPHFITLTRKEACSMDAIQRKILVKLATFSSWSKLTDDNGTSDSGDLLTTTSSDVDSSGDSKVAARSVEGEDDM
VDISMRDSHAKASGQIMPLKTFSRRRPRFADPDVFLDPELQNLFELSYLRQDSDGPVPTGWSCFDNETILDKMSD
RIPADRTSVESPDGTISGNEDSSNADETAAEPSVTRMTEESSDEDACPAPRFKNRHSRHAVSGGAGGRKKFKKHQ
TYGKKGNKRRDKQMRAPKSAQRAQVAVSPQPLPRVVPDGGPLIRLYEVIIVDWSEEAWDAVFGGTSKRHDALRGS
KTYIDIETLHDPALKMNQRRRQTRHNEGITLEQCLDEFERAEVLSEQDMWFCPRCKEHRRASKKFDLWKTPDILV
AHLKRFSNSAWRREKIDVLVDFPIEGLDLTSRVIEKEDGKVEIYDLIAIDDHYGGLGGGHYTAYAKNFVDGRWYN
FNDSSVHAVSDPQSMVTSAAYLLFYRRRSSGPLGGPRFAEISAKYDGDVGTSDGENAESGSDGRGGRQAIKAEDE
ETLPPYSATIRRSIEGDDDQGAGGYIGLEGKSLDMTQAWNFEALENRAAAGSTGGECGSDDVQFDSSDEAYRAGD
YFDQDTDMASSAAVDDGRAWTGQGVLAVPAQAGSEGDSDEVAEIHIDGDRTGRP*
Coding >Ophcf2|05034
ATGCCTTCGCCTCAGTCGCCTGGCTTAGCCCCGGGCCGCCGGACGCCTGTCGTCGTCTTGGCCGACTGCCTGGAG
AAGCCGTCGCTGGATGAGCGCGACTACCGAGTCGTCAGGCTCGAGAATGAGCTAGAGGCTTTGCTGGTTCACGAT
GCCGAGACGGACAAGGCCAGCGCTGCTCTCGATGTCAATGTTGGAAACTTCTCGGATGAAGAGGGCATGCCCGGC
ATGGCCCACGCCGTCGAACATCTCCTCTTCATGGGCACAAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTAT
CTCGCCGCCAACTCTGGCGCCTCAAACGCCTATACGGCCAGTACCTCTACCAATTACTTCTTCGATGTTGCCGCC
AAGCCGGCCAACGACGAGAATCCTTCCGATAGCAACCCCTCGCCCTTGCACGGTGCCCTCGATCGCTTTGCCCAG
TTCTTCGTCGAGCCCCTCTTCCTCCCGAGTACGCTCGACAGGGAGCTCAAGGCCGTAGATTCGGAGAACAAGAAG
AATCTTCAAAACGACACTTGGCGTCTCCATCAACTCGGAAAGTCGCTGTCTAACCCAAAGCATCCTTTCTGTCAC
TTCTCCACCGGCAACCTCAACGTGCTCAAGACGCAGCCTGAAGCGAAGGGGGTGAATGTCCGGGACAAGTTCATC
GAGTTTCATGACAAGCACTACTCGGCGAATCGGATGAAGCTCGTCGTTCTCGGCCGTGAGCCGCTCGATGTTCTT
CAGAAATGGGTCGTCGAGCTATTTTCACCCATCGTCAACAAGAAGCTGCCGCCCAACAGGTGGTCTGACGAGGTT
CCCTTCCGCGACTGCGATCTGGCGATGCAGTGCTTCGCCAAGCCCGTCATGGACACGCGCCAGCTCGAACTGACC
TTTCCCTTCGTGGACGAGGAAGCCCTCTTTGAATCGCAGCCAAGCAGGTACATTAGCCACCTCATCGGCCACGAA
GGTCCGGGGAGCATCATGTCGTACGTCAAGAACAAGGGCTGGGTCAATGGCCTCTCAGCCTGGGCCTCGTCCGTC
TGTCCTGGGACTCCGGGCATGTTCGAGGTCCAGATCCGCTTGACGGAAGAAGGTCTCAAAAATTATCCCGAGATT
GTCAAAATCTTCTTCCAGTACGTTTCGTTGCTGCGCGAGGCCTCGCCACAGGAGTGGATCTTCGACGAGCAAAAG
GGGATGGCCGACGTGGACTTCAAGTTCAGGCAAAAGACGCCGGCCAGCCGCTTCACGAGCAGGACGAGTTCCGTC
ATGCAGAAGCCTCTGCCGCGCGAGTGGCTGCTTAGTGGCAACAGCCGTCTGCGAACCTTTGACGCCAAGCTGATT
GAGAATGCGCTGTCCACGATTCGTCCTGATAAGCTGCGCCTGATGGTCGTATCGAGAACGTTTCCTGGGGACTGG
AACGCAAAGGAGAAGTGGTACGGGACGGAATACCGCTGCGAGAAGATCCCCGATGATTTGATGGCCGAGCTGAAC
CGCGCCATGGAGATGTCCGCCTCGGAGCGTCTTCCGGAGCTTCACCTGCCGCACAAGAACAACTTTATACCCAGC
AAGCTCGAGGTGGACAAGAAGGAAGTGGCGGAGCCGGCACCAGCGCCGCGCGTGCTTCGTAACGACGCTCTCGCC
CGCACCTGGTGGAAGAAGGACGACACGTTCTGGGTTCCCAAGGCCAACGTCATGGTGAGCCTCAAGAATCCCATC
ATACACGCGACGGCGGAGAACAGCGTCAAGGCGAGAATCTTCACCGAGCTCGTTCGAGACGAATTTGAGGAGTAC
TCGTACGATGCCGAGCTCGCCGGTCTGCAGTATACCGTATCGCTCGACTTGCGTGGTCTATTTCTCGACATTTCA
GGATACAATGACAAGCTTCCACTCTTGCTCAAGCAGGTCGTCGTCACCATCCGCGATCTCGACATCAGGACGGAG
CGGTTTGACATTGTCAAGGAGCGTCTGACCCGGGGTTACAAGAATTTTCAGCTGCAGTCGTCCTATCAGCAGATT
GGCGACTACGTCTCGTGGCTCAACGCCGAGCGCGACTACGTCGTGGAGGAGCTCGAGGCGGAGCTCAAGGGCATC
ACCGTCGACGCCGTCCGGCTCTTCCATAGGCAGATGCTGGCTCAGCTGTACGTCGAGATTTACGCCCACGGGAAC
CTGTACCGGGACGAGGCTCTGATGGTGACGGACATGGTCGTTTCCACCTTCAAGGCGCGCGCGCTGCCCAGGTGG
CAATGCCCCATCATCCGCTCGCTCACGCTGCCGCCAGGGTCCAACTTTGTCTTCAACAAGACGCTCGAGGACCCG
GCCAACGTCAACCACTGCGTCGAGACGTGGCTCTCCGTCGGCGACCGGGCTGATGGCCTCGCGCGTGCGAAGACG
CTGCTGATCGACCAGATGACGCATGAGCCTGCCTTTGACCAGCTCAGGACCAAGGAGCAGCTCGGATACATTGTC
TTTTCGGGCATTCGCAACTTTGCCACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAGTAC
TTGGAGAAGCGTATCGAGGCCTTCATGGCGCAGTTTGGCACGATGCTGGTGACGATGAGCGAGGCCGAGTTCGAG
GGCCACAAGCGGAGTCTCATCATCAGGCGGCTGGAGAAGCTAAGGAGTCTCGACCAGGAATCGTCGAGGCATTGG
ACTCAGATCAGCAACGAGTACTACGACTTTGAGCAAGCGCAAGTCGACGCCGCCAACATCAAGCCCCTGACCAAG
GCTGACATGGTGGACTTTTACAACGACTATCTCAGCCCGTCGTCGAGCCGTCGGGCGCGGCTGTCGGTCCACCTA
CACGCCCGTGGTGCCGGCGAACTAGACCTGAAGGTGATGGATCTCTTGCGGACGTCAGGACTCGACGAGGTGCCG
CAAGCGAAGCGCTCGTGCCTCGCTCTGCTCGACGGCCATCTCAAGGACGTGGTCAAGGTGCCTACCGAAAAGAGG
GAGGTGATTATCCGTCAGGCCAAGGAGCTCGGGCTCGACGTGACGGCCCAGAGCGCCGAGTATGACGGGGAGGAG
TCCGGGCAGCTGGCAGCGGGGCCGGCACAGGAAATCACCGACGTGCGCCGGCACAGGGCGGCTCTGCCGGCAAGC
CGTGGCGCCAGACCGGCTAAGGAGCTGAGCGAGTTTGAGGACACGGACGCCAACCATCGTCGTCCTTTCGCCTCT
CGCCCCTCCGAGCTGCCCGGGCAGCTCACTGTCAAGACGCCTTCCTCAAAGAAGAGAAAGCTCGCCCGCCCTCCC
TCGAACAACTCAAGCTCTCTGTCTCCAGATACGGCGCTGCCGTCGTGCGAGGCCGACGACGATCCCGCCTTTTCC
GTAGCCTCCGGGCTCAACACGCCGCTCTACGCACGCGCCGACTCTCTGCCGGCCTCTAGTCTGCCCCCGCGGCTG
CAGACGCAGGCTACCTCTCTCGTCTCGGCCGAGTACGCCGCTTCGGTCGCCTCGTCATCCCCTTGTGCCTCCGTC
TGCGCCGATCTTTCTCTCGATAGCGACAGAGGGGGTGAAGAGGCTGGCTCGGCTCTCAGCTTGACTAGGAGCCAG
TCACCTCTCAGGTGGTCTCGTCGGGCTATCATGAATGGTGATGACGAACTGCCTCGTCGCTCGTCATCTCCCCTC
AAGCGTCGCGCATCCGGCATGGAAGACTCCGCGTCCGACGCAGGCAACAGGTCCTCTGCCGCCGATGGTGACGTC
AACTCGTCGGGCCGTCACAATCGCGCCATGAGCGTCGACGCGCCCGAGGCAAATGGCCACGGGAGTGCCCAAGGT
CTCTCTCATCCATCGCCTCCGCTGCTGGAGCAAATCAAGATAATCGAGACGCTGCTCAAGGCTTCCAACGACTCG
CCTCTGATCAAGGACAATGCGGCCTACCTGGTCTCACGCTCGTGGTTGAACCAGGCGCTCGCTCTGCGGTCAGAT
CCCAAGTCGTCCGGCGGCTCCGGCCCGGCCGACGCCTCGTTGGGCCCCGTCGACAACTCCGACATTATTGGGGAA
ACCATCGTCGATTCGAACGGAAAAACCTTTGTTCGCCTCAAGCCTGGCCTCGGTCTCGAATCCTTTGAGCTCTTC
TCTGCCGATGCGTGGAAGCTTGTGATGGACTGGTACGGATTACAGCAAGGTCAGCACCCCATTATTCGCTTTGCC
GTCAACACCGCCGAGAACCAGCATGATCCGCCCAACATCATGTACGAGTTCCACCCGCCCGTCTTTCGCGTCCAT
CGCCTCTGGTCCCAAGTCAGCCCCTTGCCGATAGAGCAGTCCCTCAAGGAACGGAATCCGCCGCCCCTGATCGTG
GCGACCAGCTTCACCACCATCTCCCAGTCGTTCCTCAGGAGTTTGAAGACGCTCGCCGACATCCCCATGGATCGC
AAAGTTCGCTTATGGTCGGTTTCCGTTCCCGTCGTTGGCGGACAAGCGGAGCCGCAGGCGACTCTGACGCCCCCA
GACTCGCCGACGTCCCAGTCTGGGCAGTCGTGGCATAACCTGCTGGTCGACCTCCCCAGCTTCTCCCGGGCTGTT
AAGACGCGCATCGACATGGCGGACCAGACAGCCAACGACAAGTTCAACGGCAGTGCTCCTCTCAAGTACTTTCTC
AACCCTCCCGACGACACGCTCGTCATCGAAGAAGCCGTCAACGGCAGCTGGGTCAGCACCTACATATCAGACAAG
GCAGATAAATCCATTCCCTCCCAGATCAACATGGCCGTCGTATCTTCCAAGCTCAGCAGTAGCCGGAGCAGTCCC
ACTGAAGGCATGCTCACTCGCGGCCGGGCCCAAAAGAAGCGAATGGGCCGGATGGATGGGGCCGTGGGCCTGCAC
AACCTGGGAAACACGTGCTACATGAACTCGGCCCTGCAGTGCGTCCGCAGCGTGGAGGAGCTGTCGAAGTACTTC
TTGACGGAGTCGCATCTGCCCGAGATCAACGAAGCAAACGTCCTCGGCTTTCAGGGCAAATTGGCGATGGCTTAC
GGGAATCTGCTCAGGGAGATTTACGAGGAAGGGAGAAACGCGGTCAGCCCGCGCGACTTCAAAGCAACGGTCGGG
CGCTGTCGTCCCACGTTCTCTGGATGGGGACAGCAGGACTCGCAGGAGTTTCTAGGCTTCCTCCTCGACGCTCTG
CAGGAGGACTTGAGCCGCGTCAAGAAGAAGCCGTATATCGCAAAGCCCGACTCGACGGACGACATGATCAACAAT
CCCGAGGCGATTCGGCGGATGGCTGCTGAGGTCTGGGATATCACTCGACGCCGGGACGACTCGGTCATTGCCGAC
TTATTCACGGGCATGTACAAGTCGACGCTCAAGTGCCCAGAGTGCGGCAAGATCAGCATCACGTTTGACCCCTTT
TACAACCTGACGCTGCCGCTGCCTGCGGAGAGCATGTGGACCAGGCCCGTCAAGTTCTATCCGCTCCATGACGCG
CCCGTCATGCTGGACGTGGAGTTGCCCCAGCATAGCTCCATGGAGAGTCTCAAGAAATTCGTCTCAGCTCGAACC
GGCGTCCCCACCAACCGGATGATGGGGGCCGAGGAGTTTAGAGACCGCTTCTTCAAGATATACGACGACAACCAG
TATGTGTCGGAAGAGGTTACGGCGCAGGACATACCGACCTTGCACGAGGTGGAAGCGCCCCCGACGAACTGGCCA
GGCAAGGCCCCGCGCAAGAAGTTCCGGTCTATGCTAGACGTCGACATGCCCTTACACGCCGGCGAGTTCGACGAA
GAGATGAGCCAGGTCATGGCGGTGCCGGTGCTTCATCGCCGGCCCCAATGCCCCGGCGGTCGGCTTGATGGGGGC
GTGCCACCCCATTTCATCACGCTGACGAGGAAAGAGGCTTGTAGCATGGATGCGATCCAGCGCAAGATATTGGTC
AAGCTGGCTACCTTTTCCTCGTGGTCCAAGCTCACCGACGACAACGGCACGTCGGATTCGGGGGACTTGCTCACC
ACTACGTCTTCCGATGTCGATTCTTCCGGTGACAGTAAAGTCGCCGCCCGGTCGGTCGAGGGCGAGGATGACATG
GTGGACATTTCCATGAGGGACTCGCATGCCAAGGCCAGCGGCCAGATAATGCCGCTCAAGACGTTCAGCCGGCGA
CGGCCCAGGTTCGCCGACCCGGATGTCTTCCTCGATCCGGAACTGCAGAACCTATTTGAGCTATCCTATCTCCGC
CAAGACTCGGACGGTCCAGTCCCGACCGGCTGGTCGTGCTTCGATAACGAGACGATCCTGGACAAGATGTCTGAC
CGCATCCCGGCTGACCGGACCAGCGTCGAGAGTCCAGACGGCACCATCTCGGGCAACGAGGACAGCAGCAACGCG
GACGAGACGGCAGCGGAGCCGTCGGTGACGCGCATGACGGAGGAGTCGAGCGACGAGGACGCGTGTCCGGCGCCG
AGGTTCAAGAACCGCCACAGCCGACATGCCGTGAGCGGCGGTGCTGGCGGCCGCAAGAAGTTTAAGAAACACCAG
ACCTACGGCAAGAAGGGCAACAAGCGCCGCGATAAACAGATGCGCGCGCCCAAGTCTGCGCAGCGTGCGCAGGTC
GCCGTCAGTCCCCAGCCCTTGCCGCGCGTAGTGCCCGACGGAGGTCCCCTGATCCGCCTGTACGAGGTCATCATT
GTCGACTGGAGCGAGGAGGCCTGGGACGCCGTCTTTGGCGGCACCTCGAAACGCCACGATGCCTTGCGCGGTTCC
AAGACGTACATTGATATCGAGACGTTGCACGATCCCGCCCTCAAGATGAACCAGCGAAGGCGTCAGACGCGCCAT
AACGAAGGCATCACGCTGGAGCAGTGCCTGGATGAGTTTGAGCGCGCCGAAGTCCTTTCGGAGCAGGACATGTGG
TTTTGTCCTCGCTGCAAGGAGCACCGGCGGGCGAGCAAGAAGTTTGATCTGTGGAAGACGCCCGACATACTGGTC
GCTCATCTCAAGCGGTTCAGCAACTCGGCCTGGCGGCGGGAGAAGATTGACGTGCTCGTCGACTTTCCCATAGAA
GGACTCGACCTCACGTCGAGAGTGATTGAGAAGGAAGACGGCAAGGTGGAGATTTACGACCTCATCGCCATCGAC
GACCACTATGGCGGTCTCGGCGGAGGCCATTACACCGCGTACGCCAAGAACTTCGTCGACGGACGCTGGTACAAC
TTCAACGACTCTTCGGTCCACGCCGTATCGGACCCTCAGTCGATGGTGACCAGCGCCGCATACCTGCTCTTCTAC
CGACGACGTTCCAGCGGCCCGCTCGGCGGACCGCGGTTTGCCGAGATCTCGGCCAAGTACGACGGAGATGTCGGC
ACGTCTGACGGAGAAAACGCCGAGTCGGGCTCGGACGGTCGGGGAGGCCGGCAGGCTATCAAGGCTGAAGACGAA
GAGACGCTGCCGCCGTACTCGGCGACGATCCGTCGGAGCATCGAAGGCGACGACGATCAAGGAGCCGGCGGCTAC
ATTGGTCTGGAAGGAAAGTCACTGGATATGACGCAGGCCTGGAACTTTGAAGCTCTCGAGAACCGCGCGGCCGCA
GGGTCCACTGGCGGCGAATGCGGCAGCGACGACGTGCAGTTCGACTCGAGCGACGAAGCCTACCGCGCAGGCGAC
TACTTTGACCAGGACACGGACATGGCGTCGAGCGCGGCCGTCGATGACGGTAGGGCTTGGACAGGTCAGGGGGTG
CTCGCGGTGCCTGCGCAAGCCGGCAGCGAGGGTGATTCAGACGAGGTGGCCGAGATTCACATCGACGGCGACAGG
ACGGGGCGTCCGTGA
Transcript >Ophcf2|05034
ATGCCTTCGCCTCAGTCGCCTGGCTTAGCCCCGGGCCGCCGGACGCCTGTCGTCGTCTTGGCCGACTGCCTGGAG
AAGCCGTCGCTGGATGAGCGCGACTACCGAGTCGTCAGGCTCGAGAATGAGCTAGAGGCTTTGCTGGTTCACGAT
GCCGAGACGGACAAGGCCAGCGCTGCTCTCGATGTCAATGTTGGAAACTTCTCGGATGAAGAGGGCATGCCCGGC
ATGGCCCACGCCGTCGAACATCTCCTCTTCATGGGCACAAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTAT
CTCGCCGCCAACTCTGGCGCCTCAAACGCCTATACGGCCAGTACCTCTACCAATTACTTCTTCGATGTTGCCGCC
AAGCCGGCCAACGACGAGAATCCTTCCGATAGCAACCCCTCGCCCTTGCACGGTGCCCTCGATCGCTTTGCCCAG
TTCTTCGTCGAGCCCCTCTTCCTCCCGAGTACGCTCGACAGGGAGCTCAAGGCCGTAGATTCGGAGAACAAGAAG
AATCTTCAAAACGACACTTGGCGTCTCCATCAACTCGGAAAGTCGCTGTCTAACCCAAAGCATCCTTTCTGTCAC
TTCTCCACCGGCAACCTCAACGTGCTCAAGACGCAGCCTGAAGCGAAGGGGGTGAATGTCCGGGACAAGTTCATC
GAGTTTCATGACAAGCACTACTCGGCGAATCGGATGAAGCTCGTCGTTCTCGGCCGTGAGCCGCTCGATGTTCTT
CAGAAATGGGTCGTCGAGCTATTTTCACCCATCGTCAACAAGAAGCTGCCGCCCAACAGGTGGTCTGACGAGGTT
CCCTTCCGCGACTGCGATCTGGCGATGCAGTGCTTCGCCAAGCCCGTCATGGACACGCGCCAGCTCGAACTGACC
TTTCCCTTCGTGGACGAGGAAGCCCTCTTTGAATCGCAGCCAAGCAGGTACATTAGCCACCTCATCGGCCACGAA
GGTCCGGGGAGCATCATGTCGTACGTCAAGAACAAGGGCTGGGTCAATGGCCTCTCAGCCTGGGCCTCGTCCGTC
TGTCCTGGGACTCCGGGCATGTTCGAGGTCCAGATCCGCTTGACGGAAGAAGGTCTCAAAAATTATCCCGAGATT
GTCAAAATCTTCTTCCAGTACGTTTCGTTGCTGCGCGAGGCCTCGCCACAGGAGTGGATCTTCGACGAGCAAAAG
GGGATGGCCGACGTGGACTTCAAGTTCAGGCAAAAGACGCCGGCCAGCCGCTTCACGAGCAGGACGAGTTCCGTC
ATGCAGAAGCCTCTGCCGCGCGAGTGGCTGCTTAGTGGCAACAGCCGTCTGCGAACCTTTGACGCCAAGCTGATT
GAGAATGCGCTGTCCACGATTCGTCCTGATAAGCTGCGCCTGATGGTCGTATCGAGAACGTTTCCTGGGGACTGG
AACGCAAAGGAGAAGTGGTACGGGACGGAATACCGCTGCGAGAAGATCCCCGATGATTTGATGGCCGAGCTGAAC
CGCGCCATGGAGATGTCCGCCTCGGAGCGTCTTCCGGAGCTTCACCTGCCGCACAAGAACAACTTTATACCCAGC
AAGCTCGAGGTGGACAAGAAGGAAGTGGCGGAGCCGGCACCAGCGCCGCGCGTGCTTCGTAACGACGCTCTCGCC
CGCACCTGGTGGAAGAAGGACGACACGTTCTGGGTTCCCAAGGCCAACGTCATGGTGAGCCTCAAGAATCCCATC
ATACACGCGACGGCGGAGAACAGCGTCAAGGCGAGAATCTTCACCGAGCTCGTTCGAGACGAATTTGAGGAGTAC
TCGTACGATGCCGAGCTCGCCGGTCTGCAGTATACCGTATCGCTCGACTTGCGTGGTCTATTTCTCGACATTTCA
GGATACAATGACAAGCTTCCACTCTTGCTCAAGCAGGTCGTCGTCACCATCCGCGATCTCGACATCAGGACGGAG
CGGTTTGACATTGTCAAGGAGCGTCTGACCCGGGGTTACAAGAATTTTCAGCTGCAGTCGTCCTATCAGCAGATT
GGCGACTACGTCTCGTGGCTCAACGCCGAGCGCGACTACGTCGTGGAGGAGCTCGAGGCGGAGCTCAAGGGCATC
ACCGTCGACGCCGTCCGGCTCTTCCATAGGCAGATGCTGGCTCAGCTGTACGTCGAGATTTACGCCCACGGGAAC
CTGTACCGGGACGAGGCTCTGATGGTGACGGACATGGTCGTTTCCACCTTCAAGGCGCGCGCGCTGCCCAGGTGG
CAATGCCCCATCATCCGCTCGCTCACGCTGCCGCCAGGGTCCAACTTTGTCTTCAACAAGACGCTCGAGGACCCG
GCCAACGTCAACCACTGCGTCGAGACGTGGCTCTCCGTCGGCGACCGGGCTGATGGCCTCGCGCGTGCGAAGACG
CTGCTGATCGACCAGATGACGCATGAGCCTGCCTTTGACCAGCTCAGGACCAAGGAGCAGCTCGGATACATTGTC
TTTTCGGGCATTCGCAACTTTGCCACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAGTAC
TTGGAGAAGCGTATCGAGGCCTTCATGGCGCAGTTTGGCACGATGCTGGTGACGATGAGCGAGGCCGAGTTCGAG
GGCCACAAGCGGAGTCTCATCATCAGGCGGCTGGAGAAGCTAAGGAGTCTCGACCAGGAATCGTCGAGGCATTGG
ACTCAGATCAGCAACGAGTACTACGACTTTGAGCAAGCGCAAGTCGACGCCGCCAACATCAAGCCCCTGACCAAG
GCTGACATGGTGGACTTTTACAACGACTATCTCAGCCCGTCGTCGAGCCGTCGGGCGCGGCTGTCGGTCCACCTA
CACGCCCGTGGTGCCGGCGAACTAGACCTGAAGGTGATGGATCTCTTGCGGACGTCAGGACTCGACGAGGTGCCG
CAAGCGAAGCGCTCGTGCCTCGCTCTGCTCGACGGCCATCTCAAGGACGTGGTCAAGGTGCCTACCGAAAAGAGG
GAGGTGATTATCCGTCAGGCCAAGGAGCTCGGGCTCGACGTGACGGCCCAGAGCGCCGAGTATGACGGGGAGGAG
TCCGGGCAGCTGGCAGCGGGGCCGGCACAGGAAATCACCGACGTGCGCCGGCACAGGGCGGCTCTGCCGGCAAGC
CGTGGCGCCAGACCGGCTAAGGAGCTGAGCGAGTTTGAGGACACGGACGCCAACCATCGTCGTCCTTTCGCCTCT
CGCCCCTCCGAGCTGCCCGGGCAGCTCACTGTCAAGACGCCTTCCTCAAAGAAGAGAAAGCTCGCCCGCCCTCCC
TCGAACAACTCAAGCTCTCTGTCTCCAGATACGGCGCTGCCGTCGTGCGAGGCCGACGACGATCCCGCCTTTTCC
GTAGCCTCCGGGCTCAACACGCCGCTCTACGCACGCGCCGACTCTCTGCCGGCCTCTAGTCTGCCCCCGCGGCTG
CAGACGCAGGCTACCTCTCTCGTCTCGGCCGAGTACGCCGCTTCGGTCGCCTCGTCATCCCCTTGTGCCTCCGTC
TGCGCCGATCTTTCTCTCGATAGCGACAGAGGGGGTGAAGAGGCTGGCTCGGCTCTCAGCTTGACTAGGAGCCAG
TCACCTCTCAGGTGGTCTCGTCGGGCTATCATGAATGGTGATGACGAACTGCCTCGTCGCTCGTCATCTCCCCTC
AAGCGTCGCGCATCCGGCATGGAAGACTCCGCGTCCGACGCAGGCAACAGGTCCTCTGCCGCCGATGGTGACGTC
AACTCGTCGGGCCGTCACAATCGCGCCATGAGCGTCGACGCGCCCGAGGCAAATGGCCACGGGAGTGCCCAAGGT
CTCTCTCATCCATCGCCTCCGCTGCTGGAGCAAATCAAGATAATCGAGACGCTGCTCAAGGCTTCCAACGACTCG
CCTCTGATCAAGGACAATGCGGCCTACCTGGTCTCACGCTCGTGGTTGAACCAGGCGCTCGCTCTGCGGTCAGAT
CCCAAGTCGTCCGGCGGCTCCGGCCCGGCCGACGCCTCGTTGGGCCCCGTCGACAACTCCGACATTATTGGGGAA
ACCATCGTCGATTCGAACGGAAAAACCTTTGTTCGCCTCAAGCCTGGCCTCGGTCTCGAATCCTTTGAGCTCTTC
TCTGCCGATGCGTGGAAGCTTGTGATGGACTGGTACGGATTACAGCAAGGTCAGCACCCCATTATTCGCTTTGCC
GTCAACACCGCCGAGAACCAGCATGATCCGCCCAACATCATGTACGAGTTCCACCCGCCCGTCTTTCGCGTCCAT
CGCCTCTGGTCCCAAGTCAGCCCCTTGCCGATAGAGCAGTCCCTCAAGGAACGGAATCCGCCGCCCCTGATCGTG
GCGACCAGCTTCACCACCATCTCCCAGTCGTTCCTCAGGAGTTTGAAGACGCTCGCCGACATCCCCATGGATCGC
AAAGTTCGCTTATGGTCGGTTTCCGTTCCCGTCGTTGGCGGACAAGCGGAGCCGCAGGCGACTCTGACGCCCCCA
GACTCGCCGACGTCCCAGTCTGGGCAGTCGTGGCATAACCTGCTGGTCGACCTCCCCAGCTTCTCCCGGGCTGTT
AAGACGCGCATCGACATGGCGGACCAGACAGCCAACGACAAGTTCAACGGCAGTGCTCCTCTCAAGTACTTTCTC
AACCCTCCCGACGACACGCTCGTCATCGAAGAAGCCGTCAACGGCAGCTGGGTCAGCACCTACATATCAGACAAG
GCAGATAAATCCATTCCCTCCCAGATCAACATGGCCGTCGTATCTTCCAAGCTCAGCAGTAGCCGGAGCAGTCCC
ACTGAAGGCATGCTCACTCGCGGCCGGGCCCAAAAGAAGCGAATGGGCCGGATGGATGGGGCCGTGGGCCTGCAC
AACCTGGGAAACACGTGCTACATGAACTCGGCCCTGCAGTGCGTCCGCAGCGTGGAGGAGCTGTCGAAGTACTTC
TTGACGGAGTCGCATCTGCCCGAGATCAACGAAGCAAACGTCCTCGGCTTTCAGGGCAAATTGGCGATGGCTTAC
GGGAATCTGCTCAGGGAGATTTACGAGGAAGGGAGAAACGCGGTCAGCCCGCGCGACTTCAAAGCAACGGTCGGG
CGCTGTCGTCCCACGTTCTCTGGATGGGGACAGCAGGACTCGCAGGAGTTTCTAGGCTTCCTCCTCGACGCTCTG
CAGGAGGACTTGAGCCGCGTCAAGAAGAAGCCGTATATCGCAAAGCCCGACTCGACGGACGACATGATCAACAAT
CCCGAGGCGATTCGGCGGATGGCTGCTGAGGTCTGGGATATCACTCGACGCCGGGACGACTCGGTCATTGCCGAC
TTATTCACGGGCATGTACAAGTCGACGCTCAAGTGCCCAGAGTGCGGCAAGATCAGCATCACGTTTGACCCCTTT
TACAACCTGACGCTGCCGCTGCCTGCGGAGAGCATGTGGACCAGGCCCGTCAAGTTCTATCCGCTCCATGACGCG
CCCGTCATGCTGGACGTGGAGTTGCCCCAGCATAGCTCCATGGAGAGTCTCAAGAAATTCGTCTCAGCTCGAACC
GGCGTCCCCACCAACCGGATGATGGGGGCCGAGGAGTTTAGAGACCGCTTCTTCAAGATATACGACGACAACCAG
TATGTGTCGGAAGAGGTTACGGCGCAGGACATACCGACCTTGCACGAGGTGGAAGCGCCCCCGACGAACTGGCCA
GGCAAGGCCCCGCGCAAGAAGTTCCGGTCTATGCTAGACGTCGACATGCCCTTACACGCCGGCGAGTTCGACGAA
GAGATGAGCCAGGTCATGGCGGTGCCGGTGCTTCATCGCCGGCCCCAATGCCCCGGCGGTCGGCTTGATGGGGGC
GTGCCACCCCATTTCATCACGCTGACGAGGAAAGAGGCTTGTAGCATGGATGCGATCCAGCGCAAGATATTGGTC
AAGCTGGCTACCTTTTCCTCGTGGTCCAAGCTCACCGACGACAACGGCACGTCGGATTCGGGGGACTTGCTCACC
ACTACGTCTTCCGATGTCGATTCTTCCGGTGACAGTAAAGTCGCCGCCCGGTCGGTCGAGGGCGAGGATGACATG
GTGGACATTTCCATGAGGGACTCGCATGCCAAGGCCAGCGGCCAGATAATGCCGCTCAAGACGTTCAGCCGGCGA
CGGCCCAGGTTCGCCGACCCGGATGTCTTCCTCGATCCGGAACTGCAGAACCTATTTGAGCTATCCTATCTCCGC
CAAGACTCGGACGGTCCAGTCCCGACCGGCTGGTCGTGCTTCGATAACGAGACGATCCTGGACAAGATGTCTGAC
CGCATCCCGGCTGACCGGACCAGCGTCGAGAGTCCAGACGGCACCATCTCGGGCAACGAGGACAGCAGCAACGCG
GACGAGACGGCAGCGGAGCCGTCGGTGACGCGCATGACGGAGGAGTCGAGCGACGAGGACGCGTGTCCGGCGCCG
AGGTTCAAGAACCGCCACAGCCGACATGCCGTGAGCGGCGGTGCTGGCGGCCGCAAGAAGTTTAAGAAACACCAG
ACCTACGGCAAGAAGGGCAACAAGCGCCGCGATAAACAGATGCGCGCGCCCAAGTCTGCGCAGCGTGCGCAGGTC
GCCGTCAGTCCCCAGCCCTTGCCGCGCGTAGTGCCCGACGGAGGTCCCCTGATCCGCCTGTACGAGGTCATCATT
GTCGACTGGAGCGAGGAGGCCTGGGACGCCGTCTTTGGCGGCACCTCGAAACGCCACGATGCCTTGCGCGGTTCC
AAGACGTACATTGATATCGAGACGTTGCACGATCCCGCCCTCAAGATGAACCAGCGAAGGCGTCAGACGCGCCAT
AACGAAGGCATCACGCTGGAGCAGTGCCTGGATGAGTTTGAGCGCGCCGAAGTCCTTTCGGAGCAGGACATGTGG
TTTTGTCCTCGCTGCAAGGAGCACCGGCGGGCGAGCAAGAAGTTTGATCTGTGGAAGACGCCCGACATACTGGTC
GCTCATCTCAAGCGGTTCAGCAACTCGGCCTGGCGGCGGGAGAAGATTGACGTGCTCGTCGACTTTCCCATAGAA
GGACTCGACCTCACGTCGAGAGTGATTGAGAAGGAAGACGGCAAGGTGGAGATTTACGACCTCATCGCCATCGAC
GACCACTATGGCGGTCTCGGCGGAGGCCATTACACCGCGTACGCCAAGAACTTCGTCGACGGACGCTGGTACAAC
TTCAACGACTCTTCGGTCCACGCCGTATCGGACCCTCAGTCGATGGTGACCAGCGCCGCATACCTGCTCTTCTAC
CGACGACGTTCCAGCGGCCCGCTCGGCGGACCGCGGTTTGCCGAGATCTCGGCCAAGTACGACGGAGATGTCGGC
ACGTCTGACGGAGAAAACGCCGAGTCGGGCTCGGACGGTCGGGGAGGCCGGCAGGCTATCAAGGCTGAAGACGAA
GAGACGCTGCCGCCGTACTCGGCGACGATCCGTCGGAGCATCGAAGGCGACGACGATCAAGGAGCCGGCGGCTAC
ATTGGTCTGGAAGGAAAGTCACTGGATATGACGCAGGCCTGGAACTTTGAAGCTCTCGAGAACCGCGCGGCCGCA
GGGTCCACTGGCGGCGAATGCGGCAGCGACGACGTGCAGTTCGACTCGAGCGACGAAGCCTACCGCGCAGGCGAC
TACTTTGACCAGGACACGGACATGGCGTCGAGCGCGGCCGTCGATGACGGTAGGGCTTGGACAGGTCAGGGGGTG
CTCGCGGTGCCTGCGCAAGCCGGCAGCGAGGGTGATTCAGACGAGGTGGCCGAGATTCACATCGACGGCGACAGG
ACGGGGCGTCCGTGA
Gene >Ophcf2|05034
ATGCCTTCGCCTCAGTCGCCTGGCTTAGCCCCGGGCCGCCGGACGCCTGTCGTCGTCTTGGCCGACTGCCTGGAG
AAGCCGTCGCTGGATGAGCGCGACTACCGAGTCGTCAGGCTCGAGAATGAGCTAGAGGCTTTGCTGGTTCACGAT
GCCGAGACGGACAAGGCCAGCGCTGCTCTCGATGTCAATGTTGGAAACTTCTCGGATGAAGAGGGCATGCCCGGC
ATGGCCCACGCCGTCGAACATGTGCGACGCCATTTCTCCCGTCTCGTCATCGTCCTCGTCTTCCTCTTTCGTCCA
GTGCTGACCAAGGACCCTAGCTCCTCTTCATGGGCACAAAAAAGTTTCCCGTCGAAAACGAGTACAACCAGTATC
TCGCCGCCAACTCTGGCGCCTCAAACGCCTATACGGCCAGTACCTCTACCAATTACTTCTTCGATGTTGCCGCCA
AGCCGGCCAACGACGAGAATCCTTCCGATAGCAACCCCTCGCCCTTGCACGGTGCCCTCGATCGCTTTGCCCAGT
TCTTCGTCGAGCCCCTCTTCCTCCCGAGTACGCTCGACAGGGAGCTCAAGGCCGTAGATTCGGAGAACAAGAAGA
ATCTTCAAAACGACACTTGGCGTCTCCATCAACTCGGAAAGTCGCTGTCTAACCCAAAGCATCCTTTCTGTCACT
TCTCCACCGGCAACCTCAACGTGCTCAAGACGCAGCCTGAAGCGAAGGGGGTGAATGTCCGGGACAAGTTCATCG
AGTTTCATGACAAGCACTACTCGGCGAATCGGATGAAGCTCGTCGTTCTCGGCCGTGAGCCGCTCGATGTTCTTC
AGAAATGGGTCGTCGAGCTATTTTCACCCATCGTCAACAAGAAGCTGCCGCCCAACAGGTGGTCTGACGAGGTTC
CCTTCCGCGACTGCGATCTGGCGATGCAGTGCTTCGCCAAGCCCGTCATGGACACGCGCCAGCTCGAACTGACCT
TTCCCTTCGTGGACGAGGAAGCCCTCTTTGAATCGCAGCCAAGCAGGTACATTAGCCACCTCATCGGCCACGAAG
GTCCGGGGAGCATCATGTCGTACGTCAAGAACAAGGGCTGGGTCAATGGCCTCTCAGCCTGGGCCTCGTCCGTCT
GTCCTGGGACTCCGGGCATGTTCGAGGTCCAGATCCGCTTGACGGAAGAAGTATGCTGCCTCCCTTTTCATTCTG
CGGCGGCTCATCGACACTGACACAGCTTGTCACAGGGTCTCAAAAATTATCCCGAGATTGTCAAAATCTTCTTCC
AGTACGTTTCGTTGCTGCGCGAGGCCTCGCCACAGGAGTGGATCTTCGACGAGCAAAAGGGGATGGCCGACGTGG
ACTTCAAGTTCAGGCAAAAGACGCCGGCCAGCCGCTTCACGAGCAGGACGAGTTCCGTCATGCAGAAGCCTCTGC
CGCGCGAGTGGCTGCTTAGTGGCAACAGCCGTCTGCGAACCTTTGACGCCAAGCTGATTGAGAATGCGCTGTCCA
CGATTCGTCCTGATAAGCTGCGCCTGATGGTCGTATCGAGAACGTTTCCTGGGGACTGGAACGCAAAGGAGAAGT
GGTACGGGACGGAATACCGCTGCGAGAAGATCCCCGATGATTTGATGGCCGAGCTGAACCGCGCCATGGAGATGT
CCGCCTCGGAGCGTCTTCCGGAGCTTCACCTGCCGCACAAGAACAACTTTATACCCAGCAAGCTCGAGGTGGACA
AGAAGGAAGTGGCGGAGCCGGCACCAGCGCCGCGCGTGCTTCGTAACGACGCTCTCGCCCGCACCTGGTGGAAGA
AGGACGACACGTTCTGGGTTCCCAAGGCCAACGTCATGGTGAGCCTCAAGAATCCCATCATACACGCGACGGCGG
AGAACAGCGTCAAGGCGAGAATCTTCACCGAGCTCGTTCGAGACGAATTTGAGGAGTACTCGTACGATGCCGAGC
TCGCCGGTCTGCAGTATACCGTATCGCTCGACTTGCGTGGTCTATTTCTCGACATTTCAGGATACAATGACAAGC
TTCCACTCTTGCTCAAGCAGGTCGTCGTCACCATCCGCGATCTCGACATCAGGACGGAGCGGTTTGACATTGTCA
AGGAGCGTCTGACCCGGGGTTACAAGAATTTTCAGCTGCAGTCGTCCTATCAGCAGATTGGCGACTACGTCTCGT
GGCTCAACGCCGAGCGCGACTACGTCGTGGAGGAGCTCGAGGCGGAGCTCAAGGGCATCACCGTCGACGCCGTCC
GGCTCTTCCATAGGCAGATGCTGGCTCAGCTGTACGTCGAGATTTACGCCCACGGGAACCTGTACCGGGACGAGG
CTCTGATGGTGACGGACATGGTCGTTTCCACCTTCAAGGCGCGCGCGCTGCCCAGGTGGCAATGCCCCATCATCC
GCTCGCTCACGCTGCCGCCAGGGTCCAACTTTGTCTTCAACAAGACGCTCGAGGACCCGGCCAACGTCAACCACT
GCGTCGAGACGTGGCTCTCCGTCGGCGACCGGGCTGATGGCCTCGCGCGTGCGAAGACGCTGCTGATCGACCAGA
TGACGCATGAGCCTGCCTTTGACCAGCTCAGGACCAAGGAGCAGCTCGGATACATTGTCTTTTCGGGCATTCGCA
ACTTTGCCACGACCTGCGGCTTCCGCATCTTGATTCAGAGCGAGAAGACGCCCGAGTACTTGGAGAAGCGTATCG
AGGCCTTCATGGCGCAGTTTGGCACGATGCTGGTGACGATGAGCGAGGCCGAGTTCGAGGGCCACAAGCGGAGTC
TCATCATCAGGCGGCTGGAGAAGCTAAGGAGTCTCGACCAGGAATCGTCGAGGCATTGGACTCAGATCAGCAACG
AGTACTACGACTTTGAGCAAGGTGCGTGAAAGCGAGACAAGGTCGGGGTGAAACTGGCTGACGTGATGAATAGCG
CAAGTCGACGCCGCCAACATCAAGCCCCTGACCAAGGCTGACATGGTGGACTTTTACAACGACTATCTCAGCCCG
TCGTCGAGCCGTCGGGCGCGGCTGTCGGTCCACCTACACGCCCGTGGTGCCGGCGAACTAGACCTGAAGGTGATG
GATCTCTTGCGGACGTCAGGACTCGACGAGGTGCCGCAAGCGAAGCGCTCGTGCCTCGCTCTGCTCGACGGCCAT
CTCAAGGACGTGGTCAAGGTGCCTACCGAAAAGAGGGAGGTGATTATCCGTCAGGCCAAGGAGCTCGGGCTCGAC
GTGACGGCCCAGAGCGCCGAGTATGACGGGGAGGAGTCCGGGCAGCTGGCAGCGGGGCCGGCACAGGAAATCACC
GACGTGCGCCGGCACAGGGCGGCTCTGCCGGCAAGCCGTGGCGCCAGACCGGCTAAGGAGCTGAGCGAGTTTGAG
GACACGGACGCCAAGTTATGAGGAGGCTTTAGAGGCAGGCGTTGCAATTCCTCAAGGGATGCGTTGGTCAGGCAG
GTATGTATAGGTAGACAGCGATGGTGTATTTGGATCATCCCTTGTCTTTGTTCGTATGTATGCACGGGTCCAAGG
GCGAAGCTGCGTCTATCCCGGCTGCGAACAGATAGGATGCCAGTACTGTATTCGTACCTAGGTGTTTAGGTGCCT
ACATATGTAGGTAGGGAGGTAGCTGGAGGTTTACCCAAGTGGTAGGTAGCGCGCGACGACGGAACCTTAGTAAGA
ATACAGTATGAAGATGGCGCATTGAGCACGGAGTGTCTTTCCGCAGTGGGCGTTCAGGTGACGTTGGACTAGGGG
AGGGGGACCTACAAGGTGGCCCGACCTGCCAGCTGCCAGTGGCGGTTGCCGCCGTCCACCACGCAGGCACCCGCT
CTGGGTGGACGGGTGACTAATGGGCACGGACACTGTGCAAACACGGTGAGAAACGGCCAGGTCTTCCACCAGTAC
TGAGCGACTCCGCCCTGCTTCCTGGCTGTGTCAGCCCTCCTGCCCCGAAAGTCCTCTCCGCCTGGCGAAGCGCTT
CCTCGCGAAAAGGGCCAAAAAAATAAAAAAAATAAAAATAAAACACAGGACAGCGTCTTGCCGACTCTCTGCCCT
CCAGCCTCGGACGACGCGCTCCATCATCGATTCGCCAGCGACAGGAGCCTTCAGGTCCTCATCTGCCGGCTTCCA
GGTCTCGCCTCCCTGCCTTCCTTCTTCCCGAGCCTGCCTGCGATCACTGCCGCGCTTTCCAGCGTGTGTGCATGT
CTGGCCGCCGCCTCGCGCAGCCTTCTCTGCCGCCATCGTCCGATGCTGGGCTGTTTTCGCTCGTCGGCTGGCCTC
GTCATCGCCTGCAAATTTTCTTACTAAAGGTCGAGACGACAGATTGATGCCACCTCGCCGCCTGGCAGCCATCGT
CGTCCTTTCGCCTCTCGCCCCTCCGAGCTGCCCGGGCAGCTCACTGTCAAGACGCCTTCCTCAAAGAAGAGAAAG
CTCGCCCGCCCTCCCTCGAACAACTCAAGCTCTCTGTCTCCAGATACGGCGCTGCCGTCGTGCGAGGCCGACGAC
GATCCCGCCTTTTCCGTAGCCTCCGGGCTCAACACGCCGCTCTACGCACGCGCCGACTCTCTGCCGGCCTCTAGT
CTGCCCCCGCGGCTGCAGACGCAGGCTACCTCTCTCGTCTCGGCCGAGTACGCCGCTTCGGTCGCCTCGTCATCC
CCTTGTGCCTCCGTCTGCGCCGATCTTTCTCTCGATAGCGACAGAGGGGGTGAAGAGGCTGGCTCGGCTCTCAGC
TTGACTAGGAGCCAGTCACCTCTCAGGTGGTCTCGTCGGGCTATCATGAATGGTGATGACGAACTGCCTCGTCGC
TCGTCATCTCCCCTCAAGCGTCGCGCATCCGGCATGGAAGACTCCGCGTCCGACGCAGGCAACAGGTCCTCTGCC
GCCGATGGTGACGTCAACTCGTCGGGCCGTCACAATCGCGCCATGAGCGTCGACGCGCCCGAGGCAAATGGCCAC
GGGAGTGCCCAAGGTCTCTCTCATCGTTCGTTCCGCCCGAGCACTCTCCAAGTCGTTGTGTGCCTGACTAACTCG
CCACCAGCATCGCCTCCGCTGCTGGAGCAAATCAAGATAATCGAGACGCTGCTCAAGGCTTCCAACGACTCGCCT
CTGATCAAGGACAATGCGGCCTACCTGGTCTCACGCTCGTGGTTGAACCAGGCGCTCGCTCTGCGGTCAGATCCC
AAGTCGTCCGGCGGCTCCGGCCCGGCCGACGCCTCGTTGGGCCCCGTCGACAACTCCGACATTATTGGGGAAACC
ATCGTCGATTCGAACGGAAAAACCTTTGTTCGCCTCAAGCCTGGCCTCGGTCTCGAATCCTTTGAGCTCTTCTCT
GCCGATGCGTGGAAGCTTGTGATGGACTGGTACGGATTACAGCAAGGTCAGCACCCCATTATTCGCTTTGCCGTC
AACACCGCCGAGAACCAGCATGATCCGCCCAACATCATGTACGAGTTCCACCCGCCCGTCTTTCGCGTCCATCGC
CTCTGGTCCCAAGTCAGCCCCTTGCCGATAGAGCAGTCCCTCAAGGAACGGAATCCGCCGCCCCTGATCGTGGCG
ACCAGCTTCACCACCATCTCCCAGTCGTTCCTCAGGAGTTTGAAGACGCTCGCCGACATCCCCATGGATCGCAAA
GTTCGCTTATGGTCGGTTTCCGTTCCCGTCGTTGGCGGACAAGCGGAGCCGCAGGCGACTCTGACGCCCCCAGAC
TCGCCGACGTCCCAGTCTGGGCAGTCGTGGCATAACCTGCTGGTCGACCTCCCCAGCTTCTCCCGGGCTGTTAAG
ACGCGCATCGACATGGCGGACCAGACAGCCAACGACAAGTTCAACGGCAGTGCTCCTCTCAAGTACTTTCTCAAC
CCTCCCGACGACACGCTCGTCATCGAAGAAGCCGTCAACGGCAGCTGGGTCAGCACCTACATATCAGACAAGGCA
GATAAATCCATTCCCTCCCAGATCAACATGGCCGTCGTATCTTCCAAGCTCAGCAGTAGCCGGAGCAGTCCCACT
GAAGGCATGCTCACTCGCGGCCGGGCCCAAAAGAAGCGAATGGGCCGGATGGATGGGGCCGTGGGCCTGCACAAC
CTGGGAAACACGTGCTACATGAACTCGGCCCTGCAGTGCGTCCGCAGCGTGGAGGAGCTGTCGAAGTACTTCTTG
ACGGAGTCGCATCTGCCCGAGATCAACGAAGCAAACGTCCTCGGCTTTCAGGGCAAATTGGCGATGGCTTACGGG
AATCTGCTCAGGGAGATTTACGAGGAAGGGAGAAACGCGGTCAGCCCGCGCGACTTCAAAGCAACGGTCGGGCGC
TGTCGTCCCACGTTCTCTGGATGGGGACAGCAGGACTCGCAGGAGTTTCTAGGCTTCCTCCTCGACGCTCTGCAG
GAGGACTTGAGCCGCGTCAAGAAGAAGCCGTATATCGCAAAGCCCGACTCGACGGACGACATGATCAACAATCCC
GAGGCGATTCGGCGGATGGCTGCTGAGGTCTGGGATATCACTCGACGCCGGGACGACTCGGTCATTGCCGACTTA
TTCACGGGCATGTACAAGTCGACGCTCAAGTGCCCAGAGTGCGGCAAGATCAGCATCACGTTTGACCCCTTTTAC
AACCTGACGCTGCCGCTGCCTGCGGAGAGCATGTGGACCAGGCCCGTCAAGTTCTATCCGCTCCATGACGCGCCC
GTCATGCTGGACGTGGAGTTGCCCCAGCATAGCTCCATGGAGAGTCTCAAGAAATTCGTCTCAGCTCGAACCGGC
GTCCCCACCAACCGGATGATGGGGGCCGAGGAGTTTAGAGACCGCTTCTTCAAGATATACGACGACAACCAGTAT
GTGTCGGAAGAGGTTACGGCGCAGGACATACCGACCTTGCACGAGGTGGAAGCGCCCCCGACGAACTGGCCAGGC
AAGGCCCCGCGCAAGAAGTTCCGGTCTATGCTAGACGTCGACATGCCCTTACACGCCGGCGAGTTCGACGAAGAG
ATGAGCCAGGTCATGGCGGTGCCGGTGCTTCATCGCCGGCCCCAATGCCCCGGCGGTCGGCTTGATGGGGGCGTG
CCACCCCATTTCATCACGCTGACGAGGAAAGAGGCTTGTAGCATGGATGCGATCCAGCGCAAGATATTGGTCAAG
CTGGCTACCTTTTCCTCGTGGTCCAAGCTCACCGACGACAACGGCACGTCGGATTCGGGGGACTTGCTCACCACT
ACGTCTTCCGATGTCGATTCTTCCGGTGACAGTAAAGTCGCCGCCCGGTCGGTCGAGGGCGAGGATGACATGGTG
GACATTTCCATGAGGGACTCGCATGCCAAGGCCAGCGGCCAGATAATGCCGCTCAAGACGTTCAGCCGGCGACGG
CCCAGGTTCGCCGACCCGGATGTCTTCCTCGATCCGGAACTGCAGAACCTATTTGAGCTATCCTATCTCCGCCAA
GACTCGGACGGTCCAGTCCCGACCGGCTGGTCGTGCTTCGATAACGAGACGATCCTGGACAAGATGTCTGACCGC
ATCCCGGCTGACCGGACCAGCGTCGAGAGTCCAGACGGCACCATCTCGGGCAACGAGGACAGCAGCAACGCGGAC
GAGACGGCAGCGGAGCCGTCGGTGACGCGCATGACGGAGGAGTCGAGCGACGAGGACGCGTGTCCGGCGCCGAGG
GTTCGCACGCCCATCAGGAGGAGCCTGACGGCCGATTTTCATCATATGCTGACGTTTTACCAGTTCAAGAACCGC
CACAGCCGACATGCCGTGAGCGGCGGTGCTGGCGGCCGCAAGAAGTTTAAGAAACACCAGACCTACGGCAAGAAG
GGCAACAAGCGCCGCGATAAACAGATGCGCGCGCCCAAGTCTGCGCAGCGTGCGCAGGTCGCCGTCAGTCCCCAG
CCCTTGCCGCGCGTAGTGCCCGACGGAGGTCCCCTGATCCGCCTGTACGAGGTCATCATTGTCGACTGGAGCGAG
GAGGCCTGGGACGCCGTCTTTGGCGGCACCTCGAAACGCCACGATGCCTTGCGCGGTTCCAAGACGTACATTGAT
ATCGAGACGTTGCACGATCCCGCCCTCAAGATGAACCAGCGAAGGCGTCAGACGCGCCATAACGAAGGCATCACG
CTGGAGCAGTGCCTGGATGAGTTTGAGCGCGCCGAAGTCCTTTCGGAGCAGGACATGTGGTTTTGTCCTCGCTGC
AAGGAGCACCGGCGGGCGAGCAAGAAGTTTGATCTGTGGAAGACGCCCGACATACTGGTCGCTCATCTCAAGCGG
TTCAGCAACTCGGCCTGGCGGCGGGAGAAGATTGACGTGCTCGTCGACTTTCCCATAGAAGGACTCGACCTCACG
TCGAGAGTGATTGAGAAGGAAGACGGCAAGGTGGAGATTTACGACCTCATCGCCATCGACGACCACTATGGCGGT
CTCGGCGGAGGCCATTACACCGCGTACGCCAAGAACTTCGTCGACGGACGCTGGTACAACTTCAACGGTAGGCTC
GGCGCGTGAGGTTATCGACATGCTACTTGCTAACAGTTGATATTCGCAGACTCTTCGGTCCACGCCGTATCGGAC
CCTCAGTCGATGGTGACCAGCGCCGCATACCTGCTCTTCTACCGACGACGTTCCAGCGGCCCGCTCGGCGGACCG
CGGTTTGCCGAGATCTCGGCCAAGTACGACGGAGATGTCGGCACGTCTGACGGAGAAAACGCCGAGTCGGGCTCG
GACGGTCGGGGAGGCCGGCAGGCTATCAAGGCTGAAGACGAAGAGACGCTGCCGCCGTACTCGGCGACGATCCGT
CGGAGCATCGAAGGCGACGACGATCAAGGAGCCGGCGGCTACATTGGTCTGGAAGGAAAGTCACTGGATATGACG
CAGGCCTGGAACTTTGAAGCTCTCGAGAACCGCGCGGCCGCAGGGTCCACTGGCGGCGAATGCGGCAGCGACGAC
GTGCAGTTCGACTCGAGCGACGAAGCCTACCGCGCAGGCGACTACTTTGACCAGGACACGGACATGGCGTCGAGC
GCGGCCGTCGATGACGGTAGGGCTTGGACAGGTCAGGGGGTGCTCGCGGTGCCTGCGCAAGCCGGCAGCGAGGGT
GATTCAGACGAGGTGGCCGAGATTCACATCGACGGCGACAGGACGGGGCGTCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail