Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05032
Gene name
Locationscaffold_05:2311736..2312432
Strand-
Gene length (bp)696
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10276 zf-CHCC Zinc-finger domain 1.8E-14 138 173

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2253 0.2018 0.0421 0.0894 0.9477 0.2457 0.0481 0.0241 0.0328 0.0731

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|721
Ophiocordyceps australis map64 (Brazil) OphauB2|5665
Ophiocordyceps camponoti-floridani Ophcf2|05032 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4602
Ophiocordyceps subramaniannii Hirsu2|1013

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05032
MTVSPTTSFPTWRRRLLRNSDPGIMAVLRLRPIGFFARSLRVSQRAFRASPRLFEAAVPVKPSTETAIEPAQAKE
LEQPARELGQSPNRTAVWSRSQNPRATAMTGPRFEQTDMSLQPQPLSAMELIHKQPVRWTHDRVVSCEGGGGPSG
HPRIFINTDKPEIAVCNYCGLPFANEHNRKHLESLPETSYPLA*
Coding >Ophcf2|05032
ATGACCGTATCGCCGACGACCAGCTTCCCGACGTGGAGGCGTCGACTGCTTCGAAACAGCGATCCTGGCATCATG
GCCGTCCTTCGGCTGAGGCCAATCGGCTTCTTCGCCCGCAGTCTTCGAGTCTCCCAGCGAGCCTTCAGAGCCTCA
CCTCGCCTTTTCGAAGCTGCCGTCCCCGTCAAGCCGAGTACGGAAACAGCCATCGAGCCGGCCCAGGCCAAAGAG
CTCGAGCAACCGGCCAGGGAGCTCGGTCAGTCGCCTAACAGAACTGCTGTTTGGTCGCGAAGCCAAAATCCGCGC
GCCACGGCCATGACGGGTCCCCGATTCGAGCAAACAGACATGAGTTTACAGCCTCAACCATTGTCGGCGATGGAG
TTGATTCACAAACAGCCCGTTCGGTGGACGCACGACCGTGTTGTGTCGTGCGAGGGCGGCGGCGGACCCAGTGGG
CATCCCAGGATTTTCATCAACACCGACAAGCCGGAGATTGCCGTCTGCAACTACTGTGGTTTGCCCTTTGCCAAT
GAACACAACAGGAAGCATCTCGAGTCGCTTCCCGAGACGTCGTATCCTCTGGCATGA
Transcript >Ophcf2|05032
ATGACCGTATCGCCGACGACCAGCTTCCCGACGTGGAGGCGTCGACTGCTTCGAAACAGCGATCCTGGCATCATG
GCCGTCCTTCGGCTGAGGCCAATCGGCTTCTTCGCCCGCAGTCTTCGAGTCTCCCAGCGAGCCTTCAGAGCCTCA
CCTCGCCTTTTCGAAGCTGCCGTCCCCGTCAAGCCGAGTACGGAAACAGCCATCGAGCCGGCCCAGGCCAAAGAG
CTCGAGCAACCGGCCAGGGAGCTCGGTCAGTCGCCTAACAGAACTGCTGTTTGGTCGCGAAGCCAAAATCCGCGC
GCCACGGCCATGACGGGTCCCCGATTCGAGCAAACAGACATGAGTTTACAGCCTCAACCATTGTCGGCGATGGAG
TTGATTCACAAACAGCCCGTTCGGTGGACGCACGACCGTGTTGTGTCGTGCGAGGGCGGCGGCGGACCCAGTGGG
CATCCCAGGATTTTCATCAACACCGACAAGCCGGAGATTGCCGTCTGCAACTACTGTGGTTTGCCCTTTGCCAAT
GAACACAACAGGAAGCATCTCGAGTCGCTTCCCGAGACGTCGTATCCTCTGGCATGA
Gene >Ophcf2|05032
ATGACCGTATCGCCGACGACCAGCTTCCCGACGTGGAGGCGTCGACTGCTTCGAAACAGCGATCCTGGCATCATG
GCCGTCCTTCGGCTGAGGCCAATCGGCTTCTTCGCCCGCAGTCTTCGAGTCTCCCAGCGAGCCTTCAGAGCCTCA
CCTCGCCTTTTCGAAGCTGCCGTCCCCGTCAAGCCGAGTACGGAAACAGCCATCGAGCCGGCCCAGGCCAAAGAG
CTCGAGCAACCGGCCAGGGAGCTCGGTCAGTCGCCTAACAGAACTGCTGTTTGGTCGCGAAGCCAAAATCCGCGC
GCCACGGCCATGACGGGTCCCCGATTCGAGCAAACAGACATGAGTTTACAGGTGGGAGAGGCGGCCCGCGAGACG
TGAGCGTGGCTAACGCGTCGCTGACGGCACGACAGCCTCAACCATTGTCGGCGATGGAGTTGATTCACAAACAGC
CCGTTCGGTGGACGCACGACCGTGTTGTGTCGTGCGAGGGCGGCGGCGGACCCAGTGGGCATCCCAGGATTTTCA
TCAACACCGACAAGCCGGAGATTGCCGTCTGCAACTACTGTGGTTTGCCCTTTGTAGGTCCCGCTTAGCAGGCAG
TCGGGTATATACGGGTACTGACTTGGGGCTCAGGCCAATGAACACAACAGGAAGCATCTCGAGTCGCTTCCCGAG
ACGTCGTATCCTCTGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail