Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05023
Gene name
Locationscaffold_05:2290949..2293008
Strand-
Gene length (bp)2059
Transcript length (bp)1905
Coding sequence length (bp)1905
Protein length (aa) 635

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01967 MoaC MoaC family 2.5E-53 490 626
PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C 3.9E-35 247 366
PF04055 Radical_SAM Radical SAM superfamily 1.7E-23 74 238

GO

GO Term Description Terminal node
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0006777 Mo-molybdopterin cofactor biosynthetic process Yes
GO:0051539 4 iron, 4 sulfur cluster binding Yes
GO:0019008 molybdopterin synthase complex Yes
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0032991 protein-containing complex No
GO:0018130 heterocycle biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043545 molybdopterin cofactor metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0019720 Mo-molybdopterin cofactor metabolic process No
GO:0051189 prosthetic group metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0051540 metal cluster binding No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1202 0.1889 0.0233 0.0602 0.9307 0.1896 0.0431 0.0486 0.0594 0.0275

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2936
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7218
Ophiocordyceps australis map64 (Brazil) OphauB2|5674
Ophiocordyceps camponoti-floridani Ophcf2|05023 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6801
Ophiocordyceps kimflemingae Ophio5|3959
Ophiocordyceps subramaniannii Hirsu2|4928

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05023
MMMMMRLSCRPRRLLPFLAPLGPRGFRTSSEPLPEPVSPSPSPSPSRRERVRQAKPFSDFLTDTFQRRHDYLRIS
ITERCNLRCLYCMPEEGVPLSPNRDLLTTAEIVLLSSLFVSQGVTKIRLTGGEPTVRHDILPLMHQIGALRNRGL
TELCITTNGISLHRKLDSMVEAGLTGVNLSLDTLDPWQFQIMTRRKGFEAVRKSIDRVLEMNKMGAGIKLKINCV
VMRGVNDSQILPFVDMTRDRDMEVRFIEYMPFDGNRWSRGKMLAYSEMLDLIREQYPGLCKGETQANETSKTWHI
PGFAGRIGFITSMTHNFCGSCNRLRITTDGNLKVCLFGNAEVSLRDILRRTNGGEPIEDAVKAAETEETPANEAE
LLGVIGTAVKGKKAKHAGLGELEHMKNRPMILIDDMAASLTKARSMAAGWMLKRSLPTAHCRPASTAAGRNGRKQ
GEKTEPKTEEEETTTTTTTTATANEDMQLSHVSESGAARMVCIANKAVTTRTATAACTVHFSDATAGQQIRKNAN
QKGDVLSVARIAGIMAAKQTPTLIPLCHPIAISHVSVDLTLTASDQAISIRATVGCEGKTGVEMEALTAASAAAL
TVYDMCKAVDKRMRIHDLRLLLKEGGRSGRLEMD*
Coding >Ophcf2|05023
ATGATGATGATGATGAGGTTATCATGTCGGCCTCGGCGGCTGCTACCTTTCTTGGCTCCGCTCGGTCCGAGGGGC
TTCCGGACGTCATCGGAGCCGCTTCCGGAGCCGGTATCGCCGTCGCCGTCGCCGTCGCCGTCGCGCCGCGAACGA
GTCCGTCAGGCGAAGCCTTTTTCTGACTTTCTCACCGATACCTTTCAGCGTCGGCACGACTATCTACGCATCTCC
ATCACGGAGCGCTGCAACCTCCGGTGTCTGTACTGCATGCCCGAGGAGGGCGTTCCGCTCTCGCCTAACAGGGAC
CTACTCACGACGGCCGAGATCGTCCTCTTGTCCTCTCTATTCGTCTCTCAGGGCGTCACCAAGATTCGGCTGACG
GGCGGTGAGCCTACGGTGAGGCACGACATCTTGCCGCTCATGCACCAGATCGGCGCCCTACGCAATCGCGGACTC
ACGGAGCTGTGCATCACCACAAACGGAATCTCGCTCCATCGGAAGCTAGATAGCATGGTCGAGGCCGGCCTGACG
GGCGTCAACCTCAGCCTCGACACGTTGGACCCGTGGCAGTTTCAGATCATGACGCGAAGGAAAGGCTTCGAGGCC
GTCCGCAAGAGCATCGACAGAGTGCTCGAGATGAACAAGATGGGCGCCGGCATCAAACTAAAAATCAATTGCGTC
GTCATGCGCGGCGTCAACGATTCGCAGATCCTTCCCTTTGTCGACATGACGCGAGACCGGGACATGGAGGTTCGG
TTCATCGAATACATGCCGTTCGACGGCAACAGATGGAGTCGTGGCAAGATGCTTGCCTATTCAGAGATGCTCGAT
CTTATCAGAGAGCAGTATCCAGGCTTGTGCAAGGGAGAGACGCAGGCCAACGAGACGAGCAAGACGTGGCACATT
CCGGGCTTCGCCGGTCGCATCGGCTTCATCACCAGCATGACGCACAACTTTTGCGGCTCCTGCAACCGGCTCCGG
ATCACGACCGACGGAAACCTAAAAGTTTGTCTGTTTGGAAACGCCGAGGTCTCGCTACGGGACATACTCCGCCGG
ACCAACGGCGGAGAGCCCATCGAAGACGCCGTGAAAGCAGCCGAGACGGAGGAGACGCCGGCGAACGAAGCCGAG
CTTCTCGGCGTCATTGGAACGGCTGTCAAGGGGAAGAAGGCCAAGCACGCGGGTCTCGGCGAATTGGAGCACATG
AAGAATCGGCCCATGATTTTGATAGACGACATGGCTGCGTCCCTGACGAAGGCGAGATCGATGGCGGCCGGATGG
ATGTTGAAACGCAGTTTGCCGACGGCGCATTGTCGGCCGGCGTCCACGGCGGCGGGCCGGAACGGAAGAAAGCAG
GGGGAAAAGACGGAGCCGAAGACGGAGGAGGAGGAGACGACGACGACGACGACGACGACGGCGACGGCGAACGAG
GACATGCAACTGTCTCACGTATCCGAGTCGGGAGCGGCGCGAATGGTATGCATAGCGAACAAGGCGGTGACGACT
CGAACGGCAACAGCCGCGTGCACCGTCCACTTCTCAGACGCGACGGCCGGACAACAGATACGCAAAAACGCGAAC
CAAAAAGGCGACGTACTATCAGTCGCGCGCATCGCAGGCATCATGGCCGCCAAGCAAACACCAACGCTGATCCCC
CTCTGCCACCCCATCGCCATCTCGCACGTCAGCGTCGACCTCACCCTCACAGCCTCAGACCAGGCAATCTCGATC
CGGGCAACAGTAGGGTGCGAGGGCAAGACCGGGGTGGAAATGGAGGCGCTGACGGCCGCTTCGGCAGCGGCTCTG
ACCGTCTACGACATGTGCAAGGCCGTGGACAAGCGCATGCGCATCCATGATCTGCGTCTTCTCCTCAAGGAAGGC
GGTCGCTCCGGTAGGCTCGAGATGGACTGA
Transcript >Ophcf2|05023
ATGATGATGATGATGAGGTTATCATGTCGGCCTCGGCGGCTGCTACCTTTCTTGGCTCCGCTCGGTCCGAGGGGC
TTCCGGACGTCATCGGAGCCGCTTCCGGAGCCGGTATCGCCGTCGCCGTCGCCGTCGCCGTCGCGCCGCGAACGA
GTCCGTCAGGCGAAGCCTTTTTCTGACTTTCTCACCGATACCTTTCAGCGTCGGCACGACTATCTACGCATCTCC
ATCACGGAGCGCTGCAACCTCCGGTGTCTGTACTGCATGCCCGAGGAGGGCGTTCCGCTCTCGCCTAACAGGGAC
CTACTCACGACGGCCGAGATCGTCCTCTTGTCCTCTCTATTCGTCTCTCAGGGCGTCACCAAGATTCGGCTGACG
GGCGGTGAGCCTACGGTGAGGCACGACATCTTGCCGCTCATGCACCAGATCGGCGCCCTACGCAATCGCGGACTC
ACGGAGCTGTGCATCACCACAAACGGAATCTCGCTCCATCGGAAGCTAGATAGCATGGTCGAGGCCGGCCTGACG
GGCGTCAACCTCAGCCTCGACACGTTGGACCCGTGGCAGTTTCAGATCATGACGCGAAGGAAAGGCTTCGAGGCC
GTCCGCAAGAGCATCGACAGAGTGCTCGAGATGAACAAGATGGGCGCCGGCATCAAACTAAAAATCAATTGCGTC
GTCATGCGCGGCGTCAACGATTCGCAGATCCTTCCCTTTGTCGACATGACGCGAGACCGGGACATGGAGGTTCGG
TTCATCGAATACATGCCGTTCGACGGCAACAGATGGAGTCGTGGCAAGATGCTTGCCTATTCAGAGATGCTCGAT
CTTATCAGAGAGCAGTATCCAGGCTTGTGCAAGGGAGAGACGCAGGCCAACGAGACGAGCAAGACGTGGCACATT
CCGGGCTTCGCCGGTCGCATCGGCTTCATCACCAGCATGACGCACAACTTTTGCGGCTCCTGCAACCGGCTCCGG
ATCACGACCGACGGAAACCTAAAAGTTTGTCTGTTTGGAAACGCCGAGGTCTCGCTACGGGACATACTCCGCCGG
ACCAACGGCGGAGAGCCCATCGAAGACGCCGTGAAAGCAGCCGAGACGGAGGAGACGCCGGCGAACGAAGCCGAG
CTTCTCGGCGTCATTGGAACGGCTGTCAAGGGGAAGAAGGCCAAGCACGCGGGTCTCGGCGAATTGGAGCACATG
AAGAATCGGCCCATGATTTTGATAGACGACATGGCTGCGTCCCTGACGAAGGCGAGATCGATGGCGGCCGGATGG
ATGTTGAAACGCAGTTTGCCGACGGCGCATTGTCGGCCGGCGTCCACGGCGGCGGGCCGGAACGGAAGAAAGCAG
GGGGAAAAGACGGAGCCGAAGACGGAGGAGGAGGAGACGACGACGACGACGACGACGACGGCGACGGCGAACGAG
GACATGCAACTGTCTCACGTATCCGAGTCGGGAGCGGCGCGAATGGTATGCATAGCGAACAAGGCGGTGACGACT
CGAACGGCAACAGCCGCGTGCACCGTCCACTTCTCAGACGCGACGGCCGGACAACAGATACGCAAAAACGCGAAC
CAAAAAGGCGACGTACTATCAGTCGCGCGCATCGCAGGCATCATGGCCGCCAAGCAAACACCAACGCTGATCCCC
CTCTGCCACCCCATCGCCATCTCGCACGTCAGCGTCGACCTCACCCTCACAGCCTCAGACCAGGCAATCTCGATC
CGGGCAACAGTAGGGTGCGAGGGCAAGACCGGGGTGGAAATGGAGGCGCTGACGGCCGCTTCGGCAGCGGCTCTG
ACCGTCTACGACATGTGCAAGGCCGTGGACAAGCGCATGCGCATCCATGATCTGCGTCTTCTCCTCAAGGAAGGC
GGTCGCTCCGGTAGGCTCGAGATGGACTGA
Gene >Ophcf2|05023
ATGATGATGATGATGAGGTTATCATGTCGGCCTCGGCGGCTGCTACCTTTCTTGGCTCCGCTCGGTCCGAGGGGC
TTCCGGACGTCATCGGAGCCGCTTCCGGAGCCGGTATCGCCGTCGCCGTCGCCGTCGCCGTCGCGCCGCGAACGA
GTCCGTCAGGCGAAGCCTTTTTCTGACTTTCTCACCGATACCTTTCAGCGTCGGCACGACTATCTACGCATCTCC
ATCACGGAGCGCTGCAACCTCCGGTGTCTGTACTGCATGCCCGAGGAGGGCGTTCCGCTCTCGCCTAACAGGGAC
CTACTCACGACGGCCGAGATCGTCCTCTTGTCCTCTCTATTCGTCTCTCAGGGCGTCACCAAGATTCGGCTGACG
GGCGGTGAGCCTACGGTGAGGCACGACATCTTGCCGCTCATGCACCAGATCGGCGCCCTACGCAATCGCGGACTC
ACGGAGCTGTGCATCACCACAAACGGAATCTCGCTCCATCGGAAGCTAGATAGCATGGTCGAGGCCGGCCTGACG
GGCGTCAACCTCAGCCTCGACACGTTGGACCCGTGGCAGTTTCAGATCATGACGCGAAGGAAAGGCTTCGAGGCC
GTCCGCAAGAGCATCGACAGAGTGCTCGAGATGAACAAGATGGGCGCCGGCATCAAACTAAAAATCAATTGCGTC
GTCATGCGCGGCGTCAACGATTCGCAGATCCTTCCCTTTGTCGACATGACGCGAGACCGGGACATGGAGGTTCGG
TTCATCGAATACATGCCGTTCGACGGCAACAGATGGAGTCGTGGCAAGATGCTTGCCTATTCAGAGATGCTCGAT
CTTATCAGAGAGCAGTATCCAGGCTTGTGCAAGGGAGAGACGCAGGCCAACGAGACGAGCAAGACGTGGCACATT
CCGGGCTTCGCCGGTCGCATCGGCTTCATCACCAGCATGACGCACAACTTTTGCGGCTCCTGCAACCGGCTCCGG
ATCACGACCGACGGAAACCTAAAAGTTTGTCTGTTTGGAAACGCCGAGGTCTCGCTACGGGACATACTCCGCCGG
ACCAACGGCGGAGAGCCCATCGAAGACGCCGTGAAAGCAGCCGAGACGGAGGAGACGCCGGCGAACGAAGCCGAG
CTTCTCGGCGTCATTGGAACGGCTGTCAAGGGGAAGAAGGCCAAGCACGCGGGTCTCGGCGAATTGGAGCACATG
AAGAATCGGCCCATGATTTTGATAGGTGGGTGATGGCCTCTTTATTCCTTTGTCCCGTCTTTCACGCACCGGACC
ATGTCCGGCAAGGTGGTGTCGGATGCACGACGAGCGGCATTGGTTCTCGCGCTCCTGGCTGGCTAGAGGGCTGTA
CTGAGCAGCCACAACGGTCGATTCTATAGACGACATGGCTGCGTCCCTGACGAAGGCGAGATCGATGGCGGCCGG
ATGGATGTTGAAACGCAGTTTGCCGACGGCGCATTGTCGGCCGGCGTCCACGGCGGCGGGCCGGAACGGAAGAAA
GCAGGGGGAAAAGACGGAGCCGAAGACGGAGGAGGAGGAGACGACGACGACGACGACGACGACGGCGACGGCGAA
CGAGGACATGCAACTGTCTCACGTATCCGAGTCGGGAGCGGCGCGAATGGTATGCATAGCGAACAAGGCGGTGAC
GACTCGAACGGCAACAGCCGCGTGCACCGTCCACTTCTCAGACGCGACGGCCGGACAACAGATACGCAAAAACGC
GAACCAAAAAGGCGACGTACTATCAGTCGCGCGCATCGCAGGCATCATGGCCGCCAAGCAAACACCAACGCTGAT
CCCCCTCTGCCACCCCATCGCCATCTCGCACGTCAGCGTCGACCTCACCCTCACAGCCTCAGACCAGGCAATCTC
GATCCGGGCAACAGTAGGGTGCGAGGGCAAGACCGGGGTGGAAATGGAGGCGCTGACGGCCGCTTCGGCAGCGGC
TCTGACCGTCTACGACATGTGCAAGGCCGTGGACAAGCGCATGCGCATCCATGATCTGCGTCTTCTCCTCAAGGA
AGGCGGTCGCTCCGGTAGGCTCGAGATGGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail