Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05021
Gene name
Locationscaffold_05:2286096..2287657
Strand+
Gene length (bp)1561
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01151 ELO GNS1/SUR4 family 1.1E-77 53 413

GO

GO Term Description Terminal node
GO:0009922 fatty acid elongase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0004312 fatty acid synthase activity No
GO:0003824 catalytic activity No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 60 79 19
2 92 114 22
3 244 266 22
4 286 308 22
5 383 405 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05021
MAIFNAHHAAITIPNFSQFSFPPTGQPPPLAPKPTPSSVMRPFNIPENIYAAALDPRVPLTIATVYAITATALTW
YNRSRNKRPWAISKTRAFFAFVILHNVALAVYSAWTFWGMAGVMTRSIRWPWGPGGLPAMLDGFCRIHGPGRLGA
SLYYHEDSGRWLSADASAMVDALDAGGSPIGTPMGRIWSEGLDYYGWIFYLSKFYEVLDTFIILAKGKPSSILQT
YHHSGAMMCMWAGMRFMSAPIWMFASVNSLIHAFMYTYYTLTALSIKVPMRIKRTLTTMQIIQFILGAFFATLHL
FVTYLTPITVPRRDGPGMPASPTDSDIPVASGVFGSVKQLLFGPVLDETSPAISMSPLQPSSSMMTETVYVAQPC
IITRGETFAIWLNTIYLAPLTYLFVSFFIASYVKRREAGQKANGKTKHNDNVTMAEKAGWDAARGVGKVVYGSDG
SISPITPISPASSASPVSPASPVVISKGPPSPKKANGRARRRL*
Coding >Ophcf2|05021
ATGGCCATCTTCAACGCTCACCATGCCGCCATCACTATACCCAATTTCAGCCAGTTCTCCTTTCCGCCCACGGGT
CAACCTCCGCCGCTCGCACCGAAGCCGACGCCCTCCTCCGTCATGCGCCCCTTCAACATACCCGAAAACATCTAC
GCCGCCGCCCTCGATCCCCGGGTGCCGTTGACCATAGCCACCGTCTACGCCATCACGGCCACGGCTCTCACCTGG
TACAACCGCTCCCGCAACAAGCGGCCATGGGCTATCAGCAAGACGCGAGCCTTCTTCGCCTTTGTCATCCTTCAC
AACGTTGCCCTCGCCGTCTACTCGGCCTGGACCTTTTGGGGCATGGCGGGAGTCATGACCCGCAGCATTCGCTGG
CCCTGGGGCCCCGGCGGCCTCCCGGCTATGCTCGACGGCTTCTGCCGTATCCACGGCCCCGGCCGCCTCGGCGCT
TCCCTCTACTATCATGAGGACTCGGGTCGCTGGCTGAGCGCCGACGCTTCCGCCATGGTAGACGCCCTCGACGCA
GGCGGCTCGCCCATCGGCACCCCAATGGGTCGCATCTGGAGCGAGGGTCTCGACTACTACGGCTGGATCTTTTAC
CTCAGCAAGTTCTATGAGGTATTGGATACCTTTATCATCCTCGCAAAGGGCAAGCCGAGCTCTATCTTGCAGACG
TACCACCACTCGGGCGCCATGATGTGCATGTGGGCCGGCATGCGCTTCATGTCTGCGCCCATATGGATGTTTGCC
TCGGTCAACTCTCTGATTCATGCTTTCATGTACACGTACTACACCTTGACGGCCCTCTCCATCAAGGTGCCCATG
CGTATCAAGCGCACCCTCACCACGATGCAAATCATCCAGTTCATCCTCGGCGCCTTCTTCGCCACACTGCACCTC
TTCGTCACGTACCTGACTCCCATCACAGTCCCGAGACGCGACGGCCCCGGCATGCCGGCCAGCCCGACCGATTCG
GATATTCCCGTTGCCAGCGGTGTCTTCGGCTCGGTCAAGCAGCTCCTCTTCGGCCCGGTCCTGGACGAGACGTCA
CCGGCCATCTCCATGTCACCGTTGCAGCCATCGTCGTCGATGATGACGGAGACGGTTTACGTTGCGCAGCCGTGC
ATCATCACCCGTGGCGAGACGTTTGCCATTTGGCTCAACACCATCTACCTGGCGCCTCTGACGTACCTCTTCGTC
AGTTTCTTCATCGCCAGTTACGTCAAGCGAAGGGAAGCGGGTCAAAAAGCTAATGGAAAGACCAAACACAACGAC
AACGTCACTATGGCGGAGAAAGCCGGCTGGGATGCCGCTCGCGGCGTGGGCAAGGTCGTCTACGGCTCCGACGGG
AGCATAAGCCCCATCACTCCCATCAGCCCGGCCAGCTCGGCCAGCCCCGTCAGTCCCGCTAGCCCTGTGGTGATT
TCGAAGGGCCCGCCTTCGCCTAAGAAGGCCAACGGGAGGGCCAGACGGCGGCTTTGA
Transcript >Ophcf2|05021
ATGGCCATCTTCAACGCTCACCATGCCGCCATCACTATACCCAATTTCAGCCAGTTCTCCTTTCCGCCCACGGGT
CAACCTCCGCCGCTCGCACCGAAGCCGACGCCCTCCTCCGTCATGCGCCCCTTCAACATACCCGAAAACATCTAC
GCCGCCGCCCTCGATCCCCGGGTGCCGTTGACCATAGCCACCGTCTACGCCATCACGGCCACGGCTCTCACCTGG
TACAACCGCTCCCGCAACAAGCGGCCATGGGCTATCAGCAAGACGCGAGCCTTCTTCGCCTTTGTCATCCTTCAC
AACGTTGCCCTCGCCGTCTACTCGGCCTGGACCTTTTGGGGCATGGCGGGAGTCATGACCCGCAGCATTCGCTGG
CCCTGGGGCCCCGGCGGCCTCCCGGCTATGCTCGACGGCTTCTGCCGTATCCACGGCCCCGGCCGCCTCGGCGCT
TCCCTCTACTATCATGAGGACTCGGGTCGCTGGCTGAGCGCCGACGCTTCCGCCATGGTAGACGCCCTCGACGCA
GGCGGCTCGCCCATCGGCACCCCAATGGGTCGCATCTGGAGCGAGGGTCTCGACTACTACGGCTGGATCTTTTAC
CTCAGCAAGTTCTATGAGGTATTGGATACCTTTATCATCCTCGCAAAGGGCAAGCCGAGCTCTATCTTGCAGACG
TACCACCACTCGGGCGCCATGATGTGCATGTGGGCCGGCATGCGCTTCATGTCTGCGCCCATATGGATGTTTGCC
TCGGTCAACTCTCTGATTCATGCTTTCATGTACACGTACTACACCTTGACGGCCCTCTCCATCAAGGTGCCCATG
CGTATCAAGCGCACCCTCACCACGATGCAAATCATCCAGTTCATCCTCGGCGCCTTCTTCGCCACACTGCACCTC
TTCGTCACGTACCTGACTCCCATCACAGTCCCGAGACGCGACGGCCCCGGCATGCCGGCCAGCCCGACCGATTCG
GATATTCCCGTTGCCAGCGGTGTCTTCGGCTCGGTCAAGCAGCTCCTCTTCGGCCCGGTCCTGGACGAGACGTCA
CCGGCCATCTCCATGTCACCGTTGCAGCCATCGTCGTCGATGATGACGGAGACGGTTTACGTTGCGCAGCCGTGC
ATCATCACCCGTGGCGAGACGTTTGCCATTTGGCTCAACACCATCTACCTGGCGCCTCTGACGTACCTCTTCGTC
AGTTTCTTCATCGCCAGTTACGTCAAGCGAAGGGAAGCGGGTCAAAAAGCTAATGGAAAGACCAAACACAACGAC
AACGTCACTATGGCGGAGAAAGCCGGCTGGGATGCCGCTCGCGGCGTGGGCAAGGTCGTCTACGGCTCCGACGGG
AGCATAAGCCCCATCACTCCCATCAGCCCGGCCAGCTCGGCCAGCCCCGTCAGTCCCGCTAGCCCTGTGGTGATT
TCGAAGGGCCCGCCTTCGCCTAAGAAGGCCAACGGGAGGGCCAGACGGCGGCTTTGA
Gene >Ophcf2|05021
ATGGCCATCTTCAACGCTCACCATGCCGCCATCACTATACCCAATTTCAGCCAGTTCTCCTTTCCGCCCACGGGT
CAACCTCCGCCGCTCGCACCGAAGCCGACGCCCTCCTCCGTCATGCGCCCCTTCAACATACCCGAAAACATCTAC
GCCGCCGCCCTCGATCCCCGGGTGCCGTTGACCATAGCCACCGTCTACGCCATCACGGCCACGGCTCTCACCTGG
TACAACCGCTCCCGCAACAAGCGGCCATGGGCTATCAGCAAGACGCGAGCCTTCTTCGCCTTTGTCATCCTTCAC
AACGTTGCCCTCGCCGTCTACTCGGCCTGGACCTTTTGGGGCATGGCGGGAGTCATGACCCGCAGCATTCGCTGG
CCCTGGGGCCCCGGCGGCCTCCCGGCTATGCTCGACGGCTTCTGCCGTATCCACGGCCCCGGCCGCCTCGGCGCT
TCCCTCTACTATCATGAGGACTCGGGTCGCTGGCTGAGCGCCGACGCTTCCGCCATGGTAGACGCCCTCGACGCA
GGCGGCTCGCCCATCGGCACCCCAATGGGTCGCATCTGGAGCGAGGGTCTCGACTACTACGGCTGGATCTTTTAC
CTCAGCAAGTTCTATGAGGTATTGGATACCTTTATCATCCTCGCAAAGGGCAAGCCGAGCTCTATCTTGCAGACG
TACCACCACTCGGGCGCCATGATGTGCATGTGGGCCGGCATGCGCTTCATGTCTGCGCCCATATGGATGTTTGCC
TCGGTCAACTCTCTGATTCATGCTTTCATGGTGAGTCGATTTCCTTCCTTGCCTACCTACCTGCCTATCCATGCT
GTTCCTGCTTGCTGAAAATAGCTTGTTTGTACAGTACACGTACTACACCTTGACGGCCCTCTCCATCAAGGTGCC
CATGCGTATCAAGCGCACCCTCACCACGATGCAAATCATCCAGTTCATCCTCGGCGCCTTCTTCGCCACACTGCA
CCTCTTCGTCACGTACCTGACTCCCATCACAGTCCCGAGACGCGACGGCCCCGGCATGCCGGCCAGCCCGACCGA
TTCGGATATTCCCGTTGCCAGCGGTGTCTTCGGCTCGGTCAAGCAGCTCCTCTTCGGCCCGGTCCTGGACGAGAC
GTCACCGGCCATCTCCATGTCACCGTTGCAGCCATCGTCGTCGATGATGACGGAGACGGTTTACGTTGCGCAGCC
GTGCATCATCACCCGTGGCGAGACGTTTGCCATTTGGCTCAACACCATCTACCTGGCGCCTCTGACGTACCTCTT
CGTCAGTTTCTTCATCGCCAGTTACGTCAAGCGAAGGGAAGCGGGTCAAAAAGCTAATGGAAAGACCAAACACAA
CGACAACGTCACTATGGCGGAGAAAGCCGGCTGGGATGCCGCTCGCGGCGTGGGCAAGGTCGTCTACGGCTCCGA
CGGGAGCATAAGCCCCATCACTCCCATCAGCCCGGCCAGCTCGGCCAGCCCCGTCAGTCCCGCTAGCCCTGTGGT
GATTTCGAAGGGCCCGCCTTCGCCTAAGAAGGCCAACGGGAGGGCCAGACGGCGGCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail