Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05014
Gene name
Locationscaffold_05:2270957..2272661
Strand-
Gene length (bp)1704
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13347 MFS_2 MFS/sugar transport protein 7.0E-11 63 258

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 34 53 19
2 73 95 22
3 108 127 19
4 147 169 22
5 224 246 22
6 261 278 17
7 291 313 22
8 338 360 22
9 397 419 22
10 424 446 22
11 528 550 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05014
MSLPSSAPTDEAGPLLGSDPSAPCAPSARLNPLGNLVHVALLTLGFGGLQIAWSVELSHGSPYLLSLGLSKSLMA
LVWIAGPLTGSLVVPYVGVVSDKCRLRWGRRRPYLVGGTVGTVVSLLLLAWARELVSGVALLFGADVGSEGVRVA
VIVFAVVGIYLVDIAVNTVQAALRAFVVDCAPPGQQELANSMAGRLTGMGNIIGYLAGYSDLPARMPFLGDTQFK
ILCAIASLALCLTTALSVFFIHESNPLTDNHDQPVSTPGIVSFFPAMVRSIRRLPPQTRRVCRVQFFAWIGFFPL
LFYSSSYIAEIYVQPFLRAKPDMSRDEVEALYQQATRIGTFALLINAIVSLSTNVFLPLFVTPSLDSHRVPTGDG
PKPDQDGDLTRRLRIPGLTVKRAWIGSLVLYAVVMFCCPLVETVEAATALIGAAGITWAMALWAPWAIIGAEISR
RNGVRKVGHRDIRTAPTTGDEEEEDDDDDDDDDEDDQAGVILGIHNMAIAVPQIVATLGSSIIFRIWQKPRGTAG
DNSIAVVMALGGACVLLSTLFSTGIDDAYEKDTEDTEHRPVR*
Coding >Ophcf2|05014
ATGTCGCTCCCGTCCTCGGCGCCGACCGACGAGGCCGGACCCCTCCTCGGCTCCGACCCGTCGGCGCCCTGCGCT
CCCTCGGCACGGCTCAACCCCCTCGGCAACCTCGTCCACGTCGCCCTCCTGACGCTCGGCTTCGGCGGCCTCCAG
ATCGCCTGGTCGGTCGAGCTGTCGCACGGGTCCCCGTACCTGCTATCCCTGGGCCTGAGCAAGTCGCTGATGGCC
CTCGTGTGGATCGCCGGCCCGCTGACGGGCTCGCTGGTGGTTCCCTACGTCGGCGTCGTCAGCGACAAGTGCAGG
CTTCGCTGGGGGCGGCGGAGGCCCTATCTTGTTGGCGGGACCGTGGGGACTGTCGTTTCGCTTCTGCTGCTGGCT
TGGGCCCGCGAGTTGGTCAGTGGTGTTGCTTTGCTGTTTGGTGCAGACGTGGGCTCCGAGGGCGTCCGTGTTGCC
GTCATCGTCTTCGCTGTCGTGGGCATCTACCTCGTCGACATCGCCGTCAATACCGTCCAGGCTGCTCTTCGCGCC
TTTGTCGTCGACTGTGCGCCTCCCGGTCAGCAGGAGCTCGCCAACAGCATGGCCGGCCGGCTGACGGGCATGGGC
AACATCATCGGTTACCTGGCCGGTTATTCGGATCTGCCCGCCCGGATGCCCTTCCTGGGAGACACGCAGTTCAAG
ATCCTGTGCGCCATAGCCTCCCTGGCCCTGTGCCTCACCACCGCCCTCAGCGTCTTCTTCATCCACGAGAGCAAT
CCCCTTACCGACAACCATGATCAGCCCGTCAGTACGCCTGGCATCGTATCCTTCTTCCCCGCCATGGTGCGTTCC
ATTCGACGGCTGCCACCACAGACGAGACGCGTCTGTCGCGTCCAGTTCTTCGCCTGGATCGGCTTCTTCCCTCTT
CTCTTCTACTCGTCGTCGTACATTGCCGAGATATACGTGCAGCCGTTCCTCCGTGCCAAACCCGACATGTCTCGA
GACGAAGTCGAAGCCCTCTACCAGCAAGCGACACGCATCGGCACCTTTGCCCTCCTCATCAACGCCATCGTTAGC
CTATCAACCAACGTGTTCCTCCCCTTGTTCGTCACGCCCAGCCTCGACAGCCACCGGGTTCCGACCGGAGACGGA
CCGAAGCCGGACCAAGACGGCGACCTGACCCGTCGGCTGAGAATCCCCGGCCTGACAGTCAAGCGGGCGTGGATC
GGATCGCTAGTTCTATACGCCGTCGTCATGTTCTGCTGCCCGCTGGTCGAAACGGTCGAGGCCGCGACGGCGCTC
ATCGGCGCGGCCGGAATCACGTGGGCCATGGCACTATGGGCTCCGTGGGCCATCATCGGCGCCGAAATTAGTCGG
CGAAACGGAGTCCGAAAGGTGGGTCACCGCGATATCCGGACGGCGCCGACGACCGGAGACGAAGAAGAAGAAGAT
GACGATGACGATGACGATGACGATGAAGACGACCAAGCGGGTGTCATCCTCGGAATCCACAACATGGCCATCGCC
GTCCCGCAGATAGTCGCGACGCTCGGGTCGAGCATCATCTTCCGAATCTGGCAGAAGCCGCGCGGAACAGCAGGC
GACAATAGCATCGCCGTCGTCATGGCCCTCGGCGGCGCCTGCGTTCTACTTTCCACCCTGTTCTCCACGGGCATC
GACGACGCCTACGAGAAAGACACTGAGGACACTGAGCATCGCCCGGTGAGATGA
Transcript >Ophcf2|05014
ATGTCGCTCCCGTCCTCGGCGCCGACCGACGAGGCCGGACCCCTCCTCGGCTCCGACCCGTCGGCGCCCTGCGCT
CCCTCGGCACGGCTCAACCCCCTCGGCAACCTCGTCCACGTCGCCCTCCTGACGCTCGGCTTCGGCGGCCTCCAG
ATCGCCTGGTCGGTCGAGCTGTCGCACGGGTCCCCGTACCTGCTATCCCTGGGCCTGAGCAAGTCGCTGATGGCC
CTCGTGTGGATCGCCGGCCCGCTGACGGGCTCGCTGGTGGTTCCCTACGTCGGCGTCGTCAGCGACAAGTGCAGG
CTTCGCTGGGGGCGGCGGAGGCCCTATCTTGTTGGCGGGACCGTGGGGACTGTCGTTTCGCTTCTGCTGCTGGCT
TGGGCCCGCGAGTTGGTCAGTGGTGTTGCTTTGCTGTTTGGTGCAGACGTGGGCTCCGAGGGCGTCCGTGTTGCC
GTCATCGTCTTCGCTGTCGTGGGCATCTACCTCGTCGACATCGCCGTCAATACCGTCCAGGCTGCTCTTCGCGCC
TTTGTCGTCGACTGTGCGCCTCCCGGTCAGCAGGAGCTCGCCAACAGCATGGCCGGCCGGCTGACGGGCATGGGC
AACATCATCGGTTACCTGGCCGGTTATTCGGATCTGCCCGCCCGGATGCCCTTCCTGGGAGACACGCAGTTCAAG
ATCCTGTGCGCCATAGCCTCCCTGGCCCTGTGCCTCACCACCGCCCTCAGCGTCTTCTTCATCCACGAGAGCAAT
CCCCTTACCGACAACCATGATCAGCCCGTCAGTACGCCTGGCATCGTATCCTTCTTCCCCGCCATGGTGCGTTCC
ATTCGACGGCTGCCACCACAGACGAGACGCGTCTGTCGCGTCCAGTTCTTCGCCTGGATCGGCTTCTTCCCTCTT
CTCTTCTACTCGTCGTCGTACATTGCCGAGATATACGTGCAGCCGTTCCTCCGTGCCAAACCCGACATGTCTCGA
GACGAAGTCGAAGCCCTCTACCAGCAAGCGACACGCATCGGCACCTTTGCCCTCCTCATCAACGCCATCGTTAGC
CTATCAACCAACGTGTTCCTCCCCTTGTTCGTCACGCCCAGCCTCGACAGCCACCGGGTTCCGACCGGAGACGGA
CCGAAGCCGGACCAAGACGGCGACCTGACCCGTCGGCTGAGAATCCCCGGCCTGACAGTCAAGCGGGCGTGGATC
GGATCGCTAGTTCTATACGCCGTCGTCATGTTCTGCTGCCCGCTGGTCGAAACGGTCGAGGCCGCGACGGCGCTC
ATCGGCGCGGCCGGAATCACGTGGGCCATGGCACTATGGGCTCCGTGGGCCATCATCGGCGCCGAAATTAGTCGG
CGAAACGGAGTCCGAAAGGTGGGTCACCGCGATATCCGGACGGCGCCGACGACCGGAGACGAAGAAGAAGAAGAT
GACGATGACGATGACGATGACGATGAAGACGACCAAGCGGGTGTCATCCTCGGAATCCACAACATGGCCATCGCC
GTCCCGCAGATAGTCGCGACGCTCGGGTCGAGCATCATCTTCCGAATCTGGCAGAAGCCGCGCGGAACAGCAGGC
GACAATAGCATCGCCGTCGTCATGGCCCTCGGCGGCGCCTGCGTTCTACTTTCCACCCTGTTCTCCACGGGCATC
GACGACGCCTACGAGAAAGACACTGAGGACACTGAGCATCGCCCGGTGAGATGA
Gene >Ophcf2|05014
ATGTCGCTCCCGTCCTCGGCGCCGACCGACGAGGCCGGACCCCTCCTCGGCTCCGACCCGTCGGCGCCCTGCGCT
CCCTCGGCACGGCTCAACCCCCTCGGCAACCTCGTCCACGTCGCCCTCCTGACGCTCGGCTTCGGCGGCCTCCAG
ATCGCCTGGTCGGTCGAGCTGTCGCACGGGTCCCCGTACCTGCTATCCCTGGGCCTGAGCAAGTCGCTGATGGCC
CTCGTGTGGATCGCCGGCCCGCTGACGGGCTCGCTGGTGGTTCCCTACGTCGGCGTCGTCAGCGACAAGTGCAGG
CTTCGCTGGGGGCGGCGGAGGCCCTATCTTGTTGGCGGGACCGTGGGGACTGTCGTTTCGCTTCTGCTGCTGGCT
TGGGCCCGCGAGTTGGTCAGTGGTGTTGCTTTGCTGTTTGGTGCAGACGTGGGCTCCGAGGGCGTCCGTGTTGCC
GTCATCGTCTTCGCTGTCGTGGGCATCTACCTCGTCGACATCGCCGTCAATACCGTCCAGGCTGCTCTTCGCGCC
TTTGTCGTCGACTGTGCGCCTCCCGGTCAGCAGGAGCTCGCCAACAGCATGGCCGGCCGGCTGACGGGCATGGGC
AACATCATCGGTTACCTGGCCGGTTATTCGGATCTGCCCGCCCGGATGCCCTTCCTGGGAGACACGCAGTTCAAG
ATCCTGTGCGCCATAGCCTCCCTGGCCCTGTGCCTCACCACCGCCCTCAGCGTCTTCTTCATCCACGAGAGCAAT
CCCCTTACCGACAACCATGATCAGCCCGTCAGTACGCCTGGCATCGTATCCTTCTTCCCCGCCATGGTGCGTTCC
ATTCGACGGCTGCCACCACAGACGAGACGCGTCTGTCGCGTCCAGTTCTTCGCCTGGATCGGCTTCTTCCCTCTT
CTCTTCTACTCGTCGTCGTACATTGCCGAGATATACGTGCAGCCGTTCCTCCGTGCCAAACCCGACATGTCTCGA
GACGAAGTCGAAGCCCTCTACCAGCAAGCGACACGCATCGGCACCTTTGCCCTCCTCATCAACGCCATCGTTAGC
CTATCAACCAACGTGTTCCTCCCCTTGTTCGTCACGCCCAGCCTCGACAGCCACCGGGTTCCGACCGGAGACGGA
CCGAAGCCGGACCAAGACGGCGACCTGACCCGTCGGCTGAGAATCCCCGGCCTGACAGTCAAGCGGGCGTGGATC
GGATCGCTAGTTCTATACGCCGTCGTCATGTTCTGCTGCCCGCTGGTCGAAACGGTCGAGGCCGCGACGGCGCTC
ATCGGCGCGGCCGGAATCACGTGGGCCATGGCACTATGGGCTCCGTGGGCCATCATCGGCGCCGAAATTAGTCGG
CGAAACGGAGTCCGAAAGGTGGGTCACCGCGATATCCGGACGGCGCCGACGACCGGAGACGAAGAAGAAGAAGAT
GACGATGACGATGACGATGACGATGAAGACGACCAAGCGGGTGTCATCCTCGGAATCCACAACATGGCCATCGCC
GTCCCGCAGATAGTCGCGACGCTCGGGTCGAGCATCATCTTCCGAATCTGGCAGAAGCCGCGCGGAACAGCAGGC
GACAATAGCATCGCCGTCGTCATGGCCCTCGGCGGCGCCTGCGTTCTACTTTCCACCCTGTTCTCCACGGGCATC
GACGACGCCTACGAGAAAGACACTGAGGACACTGAGCATCGCCCGGTGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail