Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05013
Gene name
Locationscaffold_05:2267408..2268734
Strand+
Gene length (bp)1326
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 5.7E-09 90 159

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1084 0.0927 0.9215 0.0801 0.1039 0.0326 0.0909 0.2196 0.1241 0.0063

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999592

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH16_1 1.8E-87 67 298

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup141
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4282
Ophiocordyceps australis 1348a (Ghana) OphauG2|7690
Ophiocordyceps australis map64 (Brazil) OphauB2|1235
Ophiocordyceps australis map64 (Brazil) OphauB2|6360
Ophiocordyceps camponoti-floridani Ophcf2|02760
Ophiocordyceps camponoti-floridani Ophcf2|05013 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1197
Ophiocordyceps camponoti-rufipedis Ophun1|5796
Ophiocordyceps kimflemingae Ophio5|2893
Ophiocordyceps kimflemingae Ophio5|3428
Ophiocordyceps subramaniannii Hirsu2|1586
Ophiocordyceps subramaniannii Hirsu2|7729

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05013
MRLSATVIGLAGAVIASNGQVHTGQAYSLNVTYDQSNFFQSFDFFTGQDPTHGFVEYVDQTTARQAGLLGNTSSN
IIMGVDHQTINPLNGRRSVRVTSKQSFTRGLFVADIAHMPGSACGVWPAFWMFGPDWPKSGEIDIIEGVNTQSQA
VITLHTSPGCSVNNAGSLPTTTLKSSDCGAYGTNAGCGQQVSGSSNYGDGFNAVQGGVYATEWTSDHIAVWYFPR
SAIPKDVSGGQPNPSSWGMPMARFAGCDFDSHFSNHQLVFDTTFCGEWAGNPSVWAADKTCSSMAATCKDYVAAH
PEAFRDSYWEVKSVKVYQLGQQTAPPRPPIRQVTPTDEQPSLPSMPSDEQPYPSSTWSEDQLYPSPRQSPWGDED
AEALPGQSTSSDERPSPPRPDQQPTWAVARQALRTGVAETSSQALPTGTDWNPIYRRSFRPVRWRS*
Coding >Ophcf2|05013
ATGCGCCTCTCTGCGACCGTCATTGGCCTCGCTGGCGCCGTCATCGCTTCCAATGGACAGGTCCACACTGGCCAA
GCCTACTCGCTCAACGTCACCTACGACCAGTCCAACTTCTTTCAATCTTTCGACTTCTTCACCGGCCAGGATCCC
ACTCACGGCTTTGTCGAGTATGTCGATCAGACAACAGCCCGTCAGGCCGGTCTCCTAGGCAATACCTCCTCCAAC
ATCATCATGGGCGTCGACCACCAGACGATTAACCCTCTCAACGGCCGGCGTTCGGTCCGCGTCACGTCTAAGCAG
TCCTTCACCCGCGGTCTCTTCGTGGCCGACATCGCCCACATGCCCGGCAGCGCCTGTGGCGTCTGGCCCGCCTTT
TGGATGTTCGGCCCGGACTGGCCCAAGTCGGGCGAGATTGACATCATCGAGGGCGTCAACACGCAGTCTCAGGCT
GTCATTACGCTGCACACATCGCCGGGCTGCAGCGTCAATAACGCGGGCTCCTTGCCGACGACGACGCTGAAGTCC
TCCGACTGCGGCGCCTACGGTACCAACGCCGGCTGCGGGCAGCAGGTCAGCGGCTCCTCCAACTACGGCGACGGC
TTCAACGCTGTCCAGGGCGGCGTCTACGCTACAGAGTGGACGTCGGACCACATCGCCGTCTGGTACTTCCCCCGA
TCCGCCATCCCCAAAGACGTGTCTGGCGGTCAACCCAACCCGTCGTCGTGGGGAATGCCCATGGCCCGCTTCGCC
GGCTGCGACTTTGATTCGCACTTTTCCAATCATCAGCTCGTCTTCGATACCACCTTTTGCGGCGAGTGGGCCGGC
AACCCGTCCGTCTGGGCGGCCGACAAGACGTGCTCGTCGATGGCGGCCACATGCAAGGACTACGTCGCCGCCCAT
CCCGAGGCCTTTCGGGACTCTTACTGGGAGGTGAAGTCGGTCAAGGTCTACCAGCTGGGCCAGCAGACGGCACCG
CCGCGGCCGCCCATTCGACAGGTGACGCCGACGGATGAGCAGCCGTCCCTACCGTCGATGCCGAGCGATGAACAG
CCGTACCCATCGTCGACGTGGAGCGAAGACCAGCTGTACCCGTCGCCCCGGCAGTCGCCTTGGGGAGATGAAGAC
GCGGAAGCGCTCCCCGGACAGTCGACGTCGAGCGATGAGCGGCCTTCGCCGCCGCGGCCCGACCAGCAGCCGACG
TGGGCCGTGGCGCGGCAGGCTTTGCGAACTGGCGTGGCTGAGACGTCGTCGCAAGCCCTGCCGACGGGGACAGAC
TGGAACCCGATATATCGACGGTCGTTTAGGCCCGTGCGGTGGAGGTCGTGA
Transcript >Ophcf2|05013
ATGCGCCTCTCTGCGACCGTCATTGGCCTCGCTGGCGCCGTCATCGCTTCCAATGGACAGGTCCACACTGGCCAA
GCCTACTCGCTCAACGTCACCTACGACCAGTCCAACTTCTTTCAATCTTTCGACTTCTTCACCGGCCAGGATCCC
ACTCACGGCTTTGTCGAGTATGTCGATCAGACAACAGCCCGTCAGGCCGGTCTCCTAGGCAATACCTCCTCCAAC
ATCATCATGGGCGTCGACCACCAGACGATTAACCCTCTCAACGGCCGGCGTTCGGTCCGCGTCACGTCTAAGCAG
TCCTTCACCCGCGGTCTCTTCGTGGCCGACATCGCCCACATGCCCGGCAGCGCCTGTGGCGTCTGGCCCGCCTTT
TGGATGTTCGGCCCGGACTGGCCCAAGTCGGGCGAGATTGACATCATCGAGGGCGTCAACACGCAGTCTCAGGCT
GTCATTACGCTGCACACATCGCCGGGCTGCAGCGTCAATAACGCGGGCTCCTTGCCGACGACGACGCTGAAGTCC
TCCGACTGCGGCGCCTACGGTACCAACGCCGGCTGCGGGCAGCAGGTCAGCGGCTCCTCCAACTACGGCGACGGC
TTCAACGCTGTCCAGGGCGGCGTCTACGCTACAGAGTGGACGTCGGACCACATCGCCGTCTGGTACTTCCCCCGA
TCCGCCATCCCCAAAGACGTGTCTGGCGGTCAACCCAACCCGTCGTCGTGGGGAATGCCCATGGCCCGCTTCGCC
GGCTGCGACTTTGATTCGCACTTTTCCAATCATCAGCTCGTCTTCGATACCACCTTTTGCGGCGAGTGGGCCGGC
AACCCGTCCGTCTGGGCGGCCGACAAGACGTGCTCGTCGATGGCGGCCACATGCAAGGACTACGTCGCCGCCCAT
CCCGAGGCCTTTCGGGACTCTTACTGGGAGGTGAAGTCGGTCAAGGTCTACCAGCTGGGCCAGCAGACGGCACCG
CCGCGGCCGCCCATTCGACAGGTGACGCCGACGGATGAGCAGCCGTCCCTACCGTCGATGCCGAGCGATGAACAG
CCGTACCCATCGTCGACGTGGAGCGAAGACCAGCTGTACCCGTCGCCCCGGCAGTCGCCTTGGGGAGATGAAGAC
GCGGAAGCGCTCCCCGGACAGTCGACGTCGAGCGATGAGCGGCCTTCGCCGCCGCGGCCCGACCAGCAGCCGACG
TGGGCCGTGGCGCGGCAGGCTTTGCGAACTGGCGTGGCTGAGACGTCGTCGCAAGCCCTGCCGACGGGGACAGAC
TGGAACCCGATATATCGACGGTCGTTTAGGCCCGTGCGGTGGAGGTCGTGA
Gene >Ophcf2|05013
ATGCGCCTCTCTGCGACCGTCATTGGCCTCGCTGGCGCCGTCATCGCTTCCAATGGACAGGTCCACACTGGCCAA
GCCTACTCGCTCAACGTCACCTACGACCAGTCCAACTTCTTTCAATCTTTCGACTTCTTCACCGGCCAGGATCCC
ACTCACGGCTTTGTCGAGTATGTCGATCAGACAACAGCCCGTCAGGCCGGTCTCCTAGGCAATACCTCCTCCAAC
ATCATCATGGGCGTCGACCACCAGACGATTAACCCTCTCAACGGCCGGCGTTCGGTCCGCGTCACGTCTAAGCAG
TCCTTCACCCGCGGTCTCTTCGTGGCCGACATCGCCCACATGCCCGGCAGCGCCTGTGGCGTCTGGCCCGCCTTT
TGGATGTTCGGCCCGGACTGGCCCAAGTCGGGCGAGATTGACATCATCGAGGGCGTCAACACGCAGTCTCAGGCT
GTCATTACGCTGCACACATCGCCGGGCTGCAGCGTCAATAACGCGGGCTCCTTGCCGACGACGACGCTGAAGTCC
TCCGACTGCGGCGCCTACGGTACCAACGCCGGCTGCGGGCAGCAGGTCAGCGGCTCCTCCAACTACGGCGACGGC
TTCAACGCTGTCCAGGGCGGCGTCTACGCTACAGAGTGGACGTCGGACCACATCGCCGTCTGGTACTTCCCCCGA
TCCGCCATCCCCAAAGACGTGTCTGGCGGTCAACCCAACCCGTCGTCGTGGGGAATGCCCATGGCCCGCTTCGCC
GGCTGCGACTTTGATTCGCACTTTTCCAATCATCAGCTCGTCTTCGATACCACCTTTTGCGGCGAGTGGGCCGGC
AACCCGTCCGTCTGGGCGGCCGACAAGACGTGCTCGTCGATGGCGGCCACATGCAAGGACTACGTCGCCGCCCAT
CCCGAGGCCTTTCGGGACTCTTACTGGGAGGTGAAGTCGGTCAAGGTCTACCAGCTGGGCCAGCAGACGGCACCG
CCGCGGCCGCCCATTCGACAGGTGACGCCGACGGATGAGCAGCCGTCCCTACCGTCGATGCCGAGCGATGAACAG
CCGTACCCATCGTCGACGTGGAGCGAAGACCAGCTGTACCCGTCGCCCCGGCAGTCGCCTTGGGGAGATGAAGAC
GCGGAAGCGCTCCCCGGACAGTCGACGTCGAGCGATGAGCGGCCTTCGCCGCCGCGGCCCGACCAGCAGCCGACG
TGGGCCGTGGCGCGGCAGGCTTTGCGAACTGGCGTGGCTGAGACGTCGTCGCAAGCCCTGCCGACGGGGACAGAC
TGGAACCCGATATATCGACGGTCGTTTAGGCCCGTGCGGTGGAGGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail