Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05011
Gene name
Locationscaffold_05:2258237..2261087
Strand-
Gene length (bp)2850
Transcript length (bp)2850
Coding sequence length (bp)2850
Protein length (aa) 950

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 571 593 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 85.42 45.40 125.43
Alive In ants, during behavior modification 153.09 73.36 232.83
Dead In ants, recently dead 72.40 38.88 105.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.005578 yes
Alive Dead 0.000238 yes
Dead Fungus 0.458363 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05011
MVHMDGAKHNWLKPPALRRHGSVQDWEEWEDVMVVTPVEPENSLAEAPTPSGTRERTPPTKSSTSRNSTAKVKRL
RSRRRQKAQNAKAGIKLITDMSVFKRNNQPPPPAADTRPPKFVDAAALRALEGEPSSASIGSWNWLRRDGSRSPG
RATPEQPQPAPQPELSPEDRPIVIGISLPSDAMSSREISRQASMVDPDELTPVVDAKAAPPLRSVWSPDTPDTTN
SFDYRPSGSSLASVMANSLGGDVAPPVPALPANYSKSPRHEFDDPASFTSNRNEDDGSPCTLFEEDGGSARLRPA
RLGVSPTTPDSATSRSHGWWDHVVTPFLDKKISLLSPVSWRTKAESPREGSSSPRSGFGFAENNAGPAWSSSGSL
LPLHAPIVRKPCPRKGQSPPDSLPSEYSSTTSLPRQGQEAVGREAVVRSPDLESEKPPPYSPPKKKTVAPLQFRA
VFPTQHPLHAQFPPSPYEASPGLGATMTSQGASQTPIGRGPASPMSGVRLPARPQRAFVCHDYADTTAIRRAHKV
ERQRRRHEKEDKVARRVGGFWRGRGCVPATGCFGRRGREGRKRRRAWLMVWAGLTCVMILSVVLVVVLTGRHRDA
STPQDSIWVNLTSFPPMPTGVLTVVGLDNSVSRSACTEPSTLWSCSLPKEEHKSAEPYKANQPTVAMQIQWEKDS
ASLHDIRSEPKAPDAKEVWFLGNTTDNVRSEHKAGETTPFSISLSTTVAGLNDGSKLATNQVAGPRSGNSSLQTL
LPSPDLEADGTAAAAVMIPKALRQPLRLFDRGLESEHYGFYTHFKRTMFLKSVTILKGTEGGNVPLDEDGGCRKD
EADYVVTWAETRVLVQIWTRSLDTNASSLLRASDGGQRPGSMPYPVTLTLDTHGGDPNKKVVWSWPVDKRQKVLA
NKAELLVNRMGAGGSWINPRGSGDPRLGGFDGGTGGCKCEWVNWVRRVS*
Coding >Ophcf2|05011
ATGGTGCACATGGACGGCGCAAAGCACAACTGGCTCAAACCTCCCGCCCTGCGTCGCCATGGCAGTGTTCAGGAC
TGGGAGGAGTGGGAGGACGTCATGGTCGTGACGCCCGTCGAACCCGAAAATAGTCTCGCTGAGGCCCCGACACCG
AGTGGCACGCGGGAACGTACGCCGCCGACCAAGTCGTCGACTTCCAGGAACTCGACCGCAAAGGTCAAGAGACTT
CGCTCCAGACGGCGCCAGAAGGCCCAGAACGCAAAGGCGGGCATAAAGCTCATCACCGACATGTCCGTCTTCAAA
CGAAACAACCAACCGCCCCCCCCGGCTGCAGATACGAGGCCTCCCAAGTTTGTCGACGCCGCGGCTCTGAGGGCG
CTCGAAGGGGAGCCCAGCTCGGCCTCGATTGGTAGTTGGAACTGGCTCAGGAGGGATGGCAGCCGCAGTCCCGGT
CGTGCCACGCCGGAGCAGCCTCAGCCCGCGCCGCAACCAGAGCTATCACCCGAAGATCGGCCCATCGTCATTGGC
ATCTCTCTCCCGTCCGATGCGATGAGCTCGCGCGAAATAAGTCGACAGGCGTCCATGGTCGATCCAGACGAGTTG
ACACCCGTCGTCGATGCCAAGGCAGCCCCCCCCCTGAGATCTGTCTGGTCTCCGGACACTCCTGATACGACAAAC
TCGTTCGACTATCGTCCCAGCGGTTCAAGCCTGGCCTCGGTCATGGCCAACTCACTGGGCGGCGACGTGGCTCCT
CCGGTACCGGCGCTCCCCGCCAACTATTCCAAGTCGCCGCGACACGAATTCGACGATCCTGCATCGTTCACGAGC
AACCGCAACGAAGACGACGGCTCGCCATGCACGCTCTTCGAAGAAGATGGCGGCTCGGCTCGCCTCAGGCCCGCC
AGACTCGGTGTTAGCCCGACGACGCCTGATAGCGCTACATCGAGGTCTCATGGCTGGTGGGACCACGTCGTCACG
CCCTTTCTCGACAAGAAGATCTCTTTGCTCTCGCCCGTGAGCTGGAGAACCAAGGCCGAATCGCCCCGGGAGGGA
TCCAGTTCGCCACGGAGCGGCTTCGGGTTTGCAGAGAACAATGCCGGCCCGGCGTGGTCATCCTCGGGATCTCTG
CTGCCACTTCACGCCCCGATTGTGCGCAAGCCATGTCCCCGCAAAGGCCAGTCGCCTCCCGACAGCCTCCCGTCC
GAGTATTCATCGACGACATCGTTGCCGCGCCAAGGCCAGGAAGCTGTTGGCCGAGAGGCCGTCGTACGGAGCCCC
GACTTGGAGTCGGAGAAGCCGCCCCCTTACTCTCCGCCCAAGAAGAAGACCGTCGCGCCGCTTCAGTTTCGGGCA
GTATTTCCGACTCAACACCCGCTTCACGCTCAATTCCCGCCGTCTCCCTATGAGGCGTCGCCCGGTCTCGGGGCC
ACCATGACATCCCAGGGGGCATCGCAAACGCCCATTGGTCGGGGCCCGGCGTCGCCCATGTCCGGCGTCAGACTC
CCAGCGCGACCGCAGAGAGCGTTCGTCTGCCATGATTACGCAGATACCACGGCAATTCGCCGCGCTCACAAAGTC
GAGCGGCAAAGGCGTCGACACGAGAAGGAAGACAAGGTGGCTCGGCGCGTGGGTGGTTTCTGGCGAGGCCGTGGG
TGCGTGCCCGCGACGGGATGCTTCGGTCGCCGAGGCCGCGAAGGCCGCAAGAGGAGAAGAGCCTGGCTCATGGTG
TGGGCTGGCCTCACATGCGTCATGATCCTCTCTGTGGTGCTGGTGGTGGTTCTCACAGGGCGCCACCGTGATGCG
TCGACGCCACAAGACTCCATCTGGGTCAATCTGACGAGCTTCCCACCGATGCCGACTGGCGTCCTCACCGTCGTC
GGACTGGACAATAGCGTCTCAAGAAGCGCATGTACGGAGCCGTCGACGTTGTGGAGCTGCTCCCTGCCCAAGGAG
GAGCACAAATCGGCGGAACCGTACAAGGCGAACCAGCCGACGGTGGCGATGCAGATCCAGTGGGAAAAAGACTCG
GCGTCGTTGCACGACATTAGATCCGAACCCAAGGCCCCGGACGCCAAGGAAGTGTGGTTCCTGGGGAACACGACA
GACAACGTGCGGTCGGAGCACAAGGCGGGCGAGACAACGCCCTTTTCCATCAGCCTGTCCACGACGGTGGCCGGT
CTCAACGACGGATCCAAGTTAGCAACCAACCAAGTCGCCGGCCCGCGGAGTGGCAACTCGAGCCTGCAGACGCTT
TTGCCCTCTCCGGACTTGGAGGCAGACGGGACGGCGGCGGCGGCAGTGATGATTCCCAAGGCTTTGCGGCAGCCC
CTTCGGTTATTTGACCGCGGTTTGGAGTCGGAGCACTATGGGTTCTACACGCACTTTAAGCGGACCATGTTCCTC
AAGTCGGTCACGATACTCAAGGGGACCGAGGGCGGAAACGTGCCTCTAGACGAAGACGGAGGCTGCCGCAAAGAC
GAGGCCGACTATGTGGTGACGTGGGCGGAGACGCGAGTGCTGGTGCAGATCTGGACACGCAGCCTCGACACGAAC
GCATCGTCGCTGCTGCGGGCGAGCGACGGCGGTCAACGACCAGGCTCGATGCCATATCCGGTGACGCTGACGCTG
GACACGCACGGGGGGGATCCGAACAAAAAGGTGGTCTGGAGCTGGCCGGTGGACAAGCGACAGAAGGTGCTGGCG
AACAAGGCCGAGCTCCTGGTCAACCGGATGGGCGCCGGCGGCAGTTGGATCAACCCGCGCGGCTCGGGAGATCCG
AGGCTGGGGGGGTTTGACGGGGGGACTGGGGGGTGCAAGTGTGAGTGGGTGAACTGGGTGCGGCGGGTGTCGTGA
Transcript >Ophcf2|05011
ATGGTGCACATGGACGGCGCAAAGCACAACTGGCTCAAACCTCCCGCCCTGCGTCGCCATGGCAGTGTTCAGGAC
TGGGAGGAGTGGGAGGACGTCATGGTCGTGACGCCCGTCGAACCCGAAAATAGTCTCGCTGAGGCCCCGACACCG
AGTGGCACGCGGGAACGTACGCCGCCGACCAAGTCGTCGACTTCCAGGAACTCGACCGCAAAGGTCAAGAGACTT
CGCTCCAGACGGCGCCAGAAGGCCCAGAACGCAAAGGCGGGCATAAAGCTCATCACCGACATGTCCGTCTTCAAA
CGAAACAACCAACCGCCCCCCCCGGCTGCAGATACGAGGCCTCCCAAGTTTGTCGACGCCGCGGCTCTGAGGGCG
CTCGAAGGGGAGCCCAGCTCGGCCTCGATTGGTAGTTGGAACTGGCTCAGGAGGGATGGCAGCCGCAGTCCCGGT
CGTGCCACGCCGGAGCAGCCTCAGCCCGCGCCGCAACCAGAGCTATCACCCGAAGATCGGCCCATCGTCATTGGC
ATCTCTCTCCCGTCCGATGCGATGAGCTCGCGCGAAATAAGTCGACAGGCGTCCATGGTCGATCCAGACGAGTTG
ACACCCGTCGTCGATGCCAAGGCAGCCCCCCCCCTGAGATCTGTCTGGTCTCCGGACACTCCTGATACGACAAAC
TCGTTCGACTATCGTCCCAGCGGTTCAAGCCTGGCCTCGGTCATGGCCAACTCACTGGGCGGCGACGTGGCTCCT
CCGGTACCGGCGCTCCCCGCCAACTATTCCAAGTCGCCGCGACACGAATTCGACGATCCTGCATCGTTCACGAGC
AACCGCAACGAAGACGACGGCTCGCCATGCACGCTCTTCGAAGAAGATGGCGGCTCGGCTCGCCTCAGGCCCGCC
AGACTCGGTGTTAGCCCGACGACGCCTGATAGCGCTACATCGAGGTCTCATGGCTGGTGGGACCACGTCGTCACG
CCCTTTCTCGACAAGAAGATCTCTTTGCTCTCGCCCGTGAGCTGGAGAACCAAGGCCGAATCGCCCCGGGAGGGA
TCCAGTTCGCCACGGAGCGGCTTCGGGTTTGCAGAGAACAATGCCGGCCCGGCGTGGTCATCCTCGGGATCTCTG
CTGCCACTTCACGCCCCGATTGTGCGCAAGCCATGTCCCCGCAAAGGCCAGTCGCCTCCCGACAGCCTCCCGTCC
GAGTATTCATCGACGACATCGTTGCCGCGCCAAGGCCAGGAAGCTGTTGGCCGAGAGGCCGTCGTACGGAGCCCC
GACTTGGAGTCGGAGAAGCCGCCCCCTTACTCTCCGCCCAAGAAGAAGACCGTCGCGCCGCTTCAGTTTCGGGCA
GTATTTCCGACTCAACACCCGCTTCACGCTCAATTCCCGCCGTCTCCCTATGAGGCGTCGCCCGGTCTCGGGGCC
ACCATGACATCCCAGGGGGCATCGCAAACGCCCATTGGTCGGGGCCCGGCGTCGCCCATGTCCGGCGTCAGACTC
CCAGCGCGACCGCAGAGAGCGTTCGTCTGCCATGATTACGCAGATACCACGGCAATTCGCCGCGCTCACAAAGTC
GAGCGGCAAAGGCGTCGACACGAGAAGGAAGACAAGGTGGCTCGGCGCGTGGGTGGTTTCTGGCGAGGCCGTGGG
TGCGTGCCCGCGACGGGATGCTTCGGTCGCCGAGGCCGCGAAGGCCGCAAGAGGAGAAGAGCCTGGCTCATGGTG
TGGGCTGGCCTCACATGCGTCATGATCCTCTCTGTGGTGCTGGTGGTGGTTCTCACAGGGCGCCACCGTGATGCG
TCGACGCCACAAGACTCCATCTGGGTCAATCTGACGAGCTTCCCACCGATGCCGACTGGCGTCCTCACCGTCGTC
GGACTGGACAATAGCGTCTCAAGAAGCGCATGTACGGAGCCGTCGACGTTGTGGAGCTGCTCCCTGCCCAAGGAG
GAGCACAAATCGGCGGAACCGTACAAGGCGAACCAGCCGACGGTGGCGATGCAGATCCAGTGGGAAAAAGACTCG
GCGTCGTTGCACGACATTAGATCCGAACCCAAGGCCCCGGACGCCAAGGAAGTGTGGTTCCTGGGGAACACGACA
GACAACGTGCGGTCGGAGCACAAGGCGGGCGAGACAACGCCCTTTTCCATCAGCCTGTCCACGACGGTGGCCGGT
CTCAACGACGGATCCAAGTTAGCAACCAACCAAGTCGCCGGCCCGCGGAGTGGCAACTCGAGCCTGCAGACGCTT
TTGCCCTCTCCGGACTTGGAGGCAGACGGGACGGCGGCGGCGGCAGTGATGATTCCCAAGGCTTTGCGGCAGCCC
CTTCGGTTATTTGACCGCGGTTTGGAGTCGGAGCACTATGGGTTCTACACGCACTTTAAGCGGACCATGTTCCTC
AAGTCGGTCACGATACTCAAGGGGACCGAGGGCGGAAACGTGCCTCTAGACGAAGACGGAGGCTGCCGCAAAGAC
GAGGCCGACTATGTGGTGACGTGGGCGGAGACGCGAGTGCTGGTGCAGATCTGGACACGCAGCCTCGACACGAAC
GCATCGTCGCTGCTGCGGGCGAGCGACGGCGGTCAACGACCAGGCTCGATGCCATATCCGGTGACGCTGACGCTG
GACACGCACGGGGGGGATCCGAACAAAAAGGTGGTCTGGAGCTGGCCGGTGGACAAGCGACAGAAGGTGCTGGCG
AACAAGGCCGAGCTCCTGGTCAACCGGATGGGCGCCGGCGGCAGTTGGATCAACCCGCGCGGCTCGGGAGATCCG
AGGCTGGGGGGGTTTGACGGGGGGACTGGGGGGTGCAAGTGTGAGTGGGTGAACTGGGTGCGGCGGGTGTCGTGA
Gene >Ophcf2|05011
ATGGTGCACATGGACGGCGCAAAGCACAACTGGCTCAAACCTCCCGCCCTGCGTCGCCATGGCAGTGTTCAGGAC
TGGGAGGAGTGGGAGGACGTCATGGTCGTGACGCCCGTCGAACCCGAAAATAGTCTCGCTGAGGCCCCGACACCG
AGTGGCACGCGGGAACGTACGCCGCCGACCAAGTCGTCGACTTCCAGGAACTCGACCGCAAAGGTCAAGAGACTT
CGCTCCAGACGGCGCCAGAAGGCCCAGAACGCAAAGGCGGGCATAAAGCTCATCACCGACATGTCCGTCTTCAAA
CGAAACAACCAACCGCCCCCCCCGGCTGCAGATACGAGGCCTCCCAAGTTTGTCGACGCCGCGGCTCTGAGGGCG
CTCGAAGGGGAGCCCAGCTCGGCCTCGATTGGTAGTTGGAACTGGCTCAGGAGGGATGGCAGCCGCAGTCCCGGT
CGTGCCACGCCGGAGCAGCCTCAGCCCGCGCCGCAACCAGAGCTATCACCCGAAGATCGGCCCATCGTCATTGGC
ATCTCTCTCCCGTCCGATGCGATGAGCTCGCGCGAAATAAGTCGACAGGCGTCCATGGTCGATCCAGACGAGTTG
ACACCCGTCGTCGATGCCAAGGCAGCCCCCCCCCTGAGATCTGTCTGGTCTCCGGACACTCCTGATACGACAAAC
TCGTTCGACTATCGTCCCAGCGGTTCAAGCCTGGCCTCGGTCATGGCCAACTCACTGGGCGGCGACGTGGCTCCT
CCGGTACCGGCGCTCCCCGCCAACTATTCCAAGTCGCCGCGACACGAATTCGACGATCCTGCATCGTTCACGAGC
AACCGCAACGAAGACGACGGCTCGCCATGCACGCTCTTCGAAGAAGATGGCGGCTCGGCTCGCCTCAGGCCCGCC
AGACTCGGTGTTAGCCCGACGACGCCTGATAGCGCTACATCGAGGTCTCATGGCTGGTGGGACCACGTCGTCACG
CCCTTTCTCGACAAGAAGATCTCTTTGCTCTCGCCCGTGAGCTGGAGAACCAAGGCCGAATCGCCCCGGGAGGGA
TCCAGTTCGCCACGGAGCGGCTTCGGGTTTGCAGAGAACAATGCCGGCCCGGCGTGGTCATCCTCGGGATCTCTG
CTGCCACTTCACGCCCCGATTGTGCGCAAGCCATGTCCCCGCAAAGGCCAGTCGCCTCCCGACAGCCTCCCGTCC
GAGTATTCATCGACGACATCGTTGCCGCGCCAAGGCCAGGAAGCTGTTGGCCGAGAGGCCGTCGTACGGAGCCCC
GACTTGGAGTCGGAGAAGCCGCCCCCTTACTCTCCGCCCAAGAAGAAGACCGTCGCGCCGCTTCAGTTTCGGGCA
GTATTTCCGACTCAACACCCGCTTCACGCTCAATTCCCGCCGTCTCCCTATGAGGCGTCGCCCGGTCTCGGGGCC
ACCATGACATCCCAGGGGGCATCGCAAACGCCCATTGGTCGGGGCCCGGCGTCGCCCATGTCCGGCGTCAGACTC
CCAGCGCGACCGCAGAGAGCGTTCGTCTGCCATGATTACGCAGATACCACGGCAATTCGCCGCGCTCACAAAGTC
GAGCGGCAAAGGCGTCGACACGAGAAGGAAGACAAGGTGGCTCGGCGCGTGGGTGGTTTCTGGCGAGGCCGTGGG
TGCGTGCCCGCGACGGGATGCTTCGGTCGCCGAGGCCGCGAAGGCCGCAAGAGGAGAAGAGCCTGGCTCATGGTG
TGGGCTGGCCTCACATGCGTCATGATCCTCTCTGTGGTGCTGGTGGTGGTTCTCACAGGGCGCCACCGTGATGCG
TCGACGCCACAAGACTCCATCTGGGTCAATCTGACGAGCTTCCCACCGATGCCGACTGGCGTCCTCACCGTCGTC
GGACTGGACAATAGCGTCTCAAGAAGCGCATGTACGGAGCCGTCGACGTTGTGGAGCTGCTCCCTGCCCAAGGAG
GAGCACAAATCGGCGGAACCGTACAAGGCGAACCAGCCGACGGTGGCGATGCAGATCCAGTGGGAAAAAGACTCG
GCGTCGTTGCACGACATTAGATCCGAACCCAAGGCCCCGGACGCCAAGGAAGTGTGGTTCCTGGGGAACACGACA
GACAACGTGCGGTCGGAGCACAAGGCGGGCGAGACAACGCCCTTTTCCATCAGCCTGTCCACGACGGTGGCCGGT
CTCAACGACGGATCCAAGTTAGCAACCAACCAAGTCGCCGGCCCGCGGAGTGGCAACTCGAGCCTGCAGACGCTT
TTGCCCTCTCCGGACTTGGAGGCAGACGGGACGGCGGCGGCGGCAGTGATGATTCCCAAGGCTTTGCGGCAGCCC
CTTCGGTTATTTGACCGCGGTTTGGAGTCGGAGCACTATGGGTTCTACACGCACTTTAAGCGGACCATGTTCCTC
AAGTCGGTCACGATACTCAAGGGGACCGAGGGCGGAAACGTGCCTCTAGACGAAGACGGAGGCTGCCGCAAAGAC
GAGGCCGACTATGTGGTGACGTGGGCGGAGACGCGAGTGCTGGTGCAGATCTGGACACGCAGCCTCGACACGAAC
GCATCGTCGCTGCTGCGGGCGAGCGACGGCGGTCAACGACCAGGCTCGATGCCATATCCGGTGACGCTGACGCTG
GACACGCACGGGGGGGATCCGAACAAAAAGGTGGTCTGGAGCTGGCCGGTGGACAAGCGACAGAAGGTGCTGGCG
AACAAGGCCGAGCTCCTGGTCAACCGGATGGGCGCCGGCGGCAGTTGGATCAACCCGCGCGGCTCGGGAGATCCG
AGGCTGGGGGGGTTTGACGGGGGGACTGGGGGGTGCAAGTGTGAGTGGGTGAACTGGGTGCGGCGGGTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail