Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|05000
Gene name
Locationscaffold_05:2235666..2236313
Strand+
Gene length (bp)647
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01125 G10 G10 protein 1.7E-55 1 133

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5221 0.6121 0.3398 0.1521 0.3774 0.0384 0.0865 0.1168 0.0637 0.0493

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5140
Ophiocordyceps australis map64 (Brazil) OphauB2|6178
Ophiocordyceps camponoti-floridani Ophcf2|05000 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4519
Ophiocordyceps kimflemingae Ophio5|5791
Ophiocordyceps subramaniannii Hirsu2|8651

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|05000
MPAIRHASKRKPPPEGFSDIEDDLLIFANKMKDAHNKPPPAGPKHQAQWEVFQISHQRSRYIYDLYYEKEAISKE
LYDWLLKNNYADAMLIAKWKKQGYEQLCCLRCIQTKETSFNSTCICRVPRAQLKEDRDLQRRTGVEYSSNTRYRH
RPHASWFVLVRN*
Coding >Ophcf2|05000
ATGCCCGCGATACGCCACGCATCCAAGCGAAAGCCTCCTCCCGAAGGCTTCAGCGATATCGAAGATGACCTATTG
ATCTTCGCAAATAAGATGAAGGATGCGCACAACAAGCCCCCGCCAGCGGGCCCCAAACATCAAGCCCAGTGGGAA
GTCTTTCAGATTTCGCACCAGAGGAGCCGGTATATTTACGATCTCTACTACGAAAAAGAGGCCATCAGCAAGGAA
CTATACGACTGGCTTTTGAAGAACAACTACGCCGACGCCATGCTCATTGCCAAATGGAAGAAACAAGGATATGAA
CAGCTTTGCTGCCTCCGATGTATTCAGACAAAGGAAACCAGCTTCAACAGCACTTGCATCTGCCGAGTCCCTCGG
GCTCAACTGAAGGAGGACAGAGATCTTCAGCGTCGAACCGGTGTTGAATATTCATCAAATACCCGTTATCGACAC
CGGCCTCATGCGTCCTGGTTTGTTTTGGTCCGAAACTAG
Transcript >Ophcf2|05000
ATGCCCGCGATACGCCACGCATCCAAGCGAAAGCCTCCTCCCGAAGGCTTCAGCGATATCGAAGATGACCTATTG
ATCTTCGCAAATAAGATGAAGGATGCGCACAACAAGCCCCCGCCAGCGGGCCCCAAACATCAAGCCCAGTGGGAA
GTCTTTCAGATTTCGCACCAGAGGAGCCGGTATATTTACGATCTCTACTACGAAAAAGAGGCCATCAGCAAGGAA
CTATACGACTGGCTTTTGAAGAACAACTACGCCGACGCCATGCTCATTGCCAAATGGAAGAAACAAGGATATGAA
CAGCTTTGCTGCCTCCGATGTATTCAGACAAAGGAAACCAGCTTCAACAGCACTTGCATCTGCCGAGTCCCTCGG
GCTCAACTGAAGGAGGACAGAGATCTTCAGCGTCGAACCGGTGTTGAATATTCATCAAATACCCGTTATCGACAC
CGGCCTCATGCGTCCTGGTTTGTTTTGGTCCGAAACTAG
Gene >Ophcf2|05000
ATGCCCGCGATACGCCACGCATCCAAGCGAAAGCCTCCTCCCGAAGGCTTCAGCGATATCGAAGATGACCTATTG
ATCTTCGCAAATAAGATGAAGGATGCGCACAACAAGCCCCCGCCAGCGGGCCCCAAACATCAAGCCCAGTGGGAA
GTCTTTCAGATTTCGCACCAGAGGAGCCGGTATATTTACGATCTCTACTACGAAAAAGAGGCCATCAGCAAGGAA
CTATACGACTGGCTTTTGAAGAACAACTACGCCGACGCCATGCTCATTGCCAAATGGAAGAAACAAGGATATGAA
CAGGCATGCTCCCGATGCAATAGCGACACCCGCAAGCCCCGGCTAACCCGCTCCAGCTTTGCTGCCTCCGATGTA
TTCAGACAAAGGAAACCAGCTTCAACAGCACTTGCATCTGCCGAGTCCCTCGGGCTCAACTGAAGGAGGACAGAG
ATCTTCAGTGTGTCAGCTGCGGCTGTAGAGGTTGTGCCTCGACCGATTAACTCAAGGCGTCGAACCGGTGTTGAA
TATTCATCAAATACCCGTTATCGACACCGGCCTCATGCGTCCTGGTTTGTTTTGGTCCGAAACGTCAGAAATAAG
TGTCAACCTCGACTCTCCACCACGTTGCTGATTTTGCTTCGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail