Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04999
Gene name
Locationscaffold_05:2234880..2235489
Strand-
Gene length (bp)609
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13233 Complex1_LYR_2 Complex1_LYR-like 1.0E-04 29 98
PF05347 Complex1_LYR Complex 1 protein (LYR family) 1.3E-04 24 75

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2773 0.1144 0.037 0.0769 0.9546 0.0309 0.0392 0.0423 0.0437 0.0046

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4239
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5139
Ophiocordyceps australis map64 (Brazil) OphauB2|6177
Ophiocordyceps camponoti-floridani Ophcf2|04999 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4518
Ophiocordyceps kimflemingae Ophio5|5792
Ophiocordyceps subramaniannii Hirsu2|8652

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04999
MAITPTQFAKKTAQSASWADAKRRVLWSYREWIRAAPEMQSMYNVPLPVSAIRTRIRQEFERNRFVTKLPVVDVL
LFKSHTEYQETMNFWKQTTHIMSYFKGENFRDDKRLPTNFMDGFLEGRN*
Coding >Ophcf2|04999
ATGGCCATCACGCCGACCCAATTCGCCAAGAAGACGGCGCAATCCGCCAGCTGGGCGGATGCGAAGCGCCGAGTG
CTCTGGTCATATCGCGAATGGATCCGAGCTGCTCCAGAAATGCAAAGCATGTACAACGTGCCTCTGCCAGTCTCG
GCGATTCGCACGCGGATCAGACAAGAGTTCGAGCGAAATCGATTTGTTACCAAGCTGCCCGTCGTCGACGTTCTG
CTCTTCAAATCACACACGGAATATCAAGAGACCATGAACTTCTGGAAGCAGACAACCCATATTATGTCCTACTTC
AAGGGAGAGAACTTCCGTGACGACAAGAGACTGCCGACAAACTTCATGGATGGGTTCCTCGAGGGTCGGAACTAA
Transcript >Ophcf2|04999
ATGGCCATCACGCCGACCCAATTCGCCAAGAAGACGGCGCAATCCGCCAGCTGGGCGGATGCGAAGCGCCGAGTG
CTCTGGTCATATCGCGAATGGATCCGAGCTGCTCCAGAAATGCAAAGCATGTACAACGTGCCTCTGCCAGTCTCG
GCGATTCGCACGCGGATCAGACAAGAGTTCGAGCGAAATCGATTTGTTACCAAGCTGCCCGTCGTCGACGTTCTG
CTCTTCAAATCACACACGGAATATCAAGAGACCATGAACTTCTGGAAGCAGACAACCCATATTATGTCCTACTTC
AAGGGAGAGAACTTCCGTGACGACAAGAGACTGCCGACAAACTTCATGGATGGGTTCCTCGAGGGTCGGAACTAA
Gene >Ophcf2|04999
ATGGCCATCACGCCGACCCAATTCGCCAAGAAGACGGCGCAATGTGAGTTACTATCCCTTTGTGTGCATATTTTC
GTGCTAACATTGTGGACAGCCGCCAGCTGGGCGGATGCGAAGCGCCGAGTGCTCTGGTCATATCGCGAATGGATC
CGAGCTGTACGTTTTTATCCTTCATTGTCTCGATTTAGCGGGCGCTGAGCTTCCACAATGCTGATGCTAATGTTA
TACAGGCTCCAGAAATGCAAAGCATGTACAACGTGCCTCTGCCAGTCTCGGCGATTCGCACGCGGATCAGACAAG
AGTTCGAGCGAAATCGATTTGTTACCAAGCTGCCCGTCGTCGACGTTCTGCTCTTCAAATCACACACGGAATATC
AAGTACGGCATAGGTGAAAGAGATACGCTACAGAGGTCTTGTTCTGACATGGCCAACAGGAGACCATGAACTTCT
GGAAGCAGACAACCCATATTATGTCCTACTTCAAGGGAGAGAACTTCCGTGACGACAAGAGACTGCCGACAAACT
TCATGGATGGGTTCCTCGAGGTCGGTAGTATTGAGGTCGTGAGCGCGGACGCAATGCTAAGTCTTTAAACAGGGT
CGGAACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail