Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04998
Gene name
Locationscaffold_05:2234167..2234750
Strand+
Gene length (bp)583
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 8.5E-31 49 120
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 3.4E-13 50 115

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0046983 protein dimerization activity Yes
GO:0006351 transcription, DNA-templated Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0009059 macromolecule biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0005515 protein binding No
GO:0097659 nucleic acid-templated transcription No
GO:0090304 nucleic acid metabolic process No
GO:0003824 catalytic activity No
GO:0016070 RNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0097747 RNA polymerase activity No
GO:0034062 5'-3' RNA polymerase activity No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6951 0.6291 0.0254 0.0297 0.122 0.016 0.0863 0.0832 0.1031 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4240
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5138
Ophiocordyceps australis map64 (Brazil) OphauB2|6176
Ophiocordyceps camponoti-floridani Ophcf2|04998 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4517
Ophiocordyceps kimflemingae Ophio5|5793
Ophiocordyceps subramaniannii Hirsu2|8653

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04998
MQNAPPSAQPEDTQDVEMGEDEGEPGEGQDEMEEAQRVAILPGSTDSAASFEFLNEGHTLGNALRYIIMKNPNVE
FCAYAIPHPSEPKMNIRIQTTEGTAVDALRKGLLDLQDVCDVVAKEYWDKRCAFNVEKGLT*
Coding >Ophcf2|04998
ATGCAGAACGCGCCACCGTCGGCACAGCCCGAAGATACTCAGGATGTCGAGATGGGCGAGGATGAAGGCGAACCG
GGAGAAGGCCAAGACGAGATGGAGGAGGCACAGCGGGTGGCAATCCTGCCCGGTTCGACAGATTCTGCTGCATCC
TTTGAGTTCTTGAATGAGGGACACACTCTGGGCAATGCCCTGAGATATATCATCATGAAGAACCCAAACGTCGAG
TTTTGCGCCTACGCCATCCCTCACCCTTCCGAGCCCAAGATGAATATCAGGATACAAACAACTGAAGGCACTGCG
GTGGATGCCTTGAGAAAGGGGCTGCTTGACCTGCAAGACGTGTGCGATGTTGTGGCCAAAGAATACTGGGATAAG
AGATGCGCCTTCAACGTCGAAAAGGGTCTGACGTGA
Transcript >Ophcf2|04998
ATGCAGAACGCGCCACCGTCGGCACAGCCCGAAGATACTCAGGATGTCGAGATGGGCGAGGATGAAGGCGAACCG
GGAGAAGGCCAAGACGAGATGGAGGAGGCACAGCGGGTGGCAATCCTGCCCGGTTCGACAGATTCTGCTGCATCC
TTTGAGTTCTTGAATGAGGGACACACTCTGGGCAATGCCCTGAGATATATCATCATGAAGAACCCAAACGTCGAG
TTTTGCGCCTACGCCATCCCTCACCCTTCCGAGCCCAAGATGAATATCAGGATACAAACAACTGAAGGCACTGCG
GTGGATGCCTTGAGAAAGGGGCTGCTTGACCTGCAAGACGTGTGCGATGTTGTGGCCAAAGAATACTGGGATAAG
AGATGCGCCTTCAACGTCGAAAAGGGTCTGACGTGA
Gene >Ophcf2|04998
ATGCAGAACGCGCCACCGTCGGCACAGCCCGAAGATACTCAGGATGTCGAGATGGGCGAGGATGAAGGCGAACCG
GGAGAAGGCCAAGACGAGATGGAGGAGGCACAGCGGGTGGCAATCGTACGGCTGCTCCCTATCTGGACAGGCAAT
CTGAGCCCGGCTGACCATGTCATGTCCAGCTGCCCGGTTCGACAGATTCTGCTGCATCCTTTGAGTTCTTGAATG
AGGGACACACTCTGGGCAATGCCCTGAGATATATCATCATGAAGAAGTGGGCAGACTCATCTGGCTAGCATTTGT
TTCGCGTGAAGCAGCTGACCCGTCCAAGCCCAAACGTCGAGTTTTGCGCCTACGCCATCCCTCACCCTTCCGAGC
CCAAGATGAATATCAGGATACAAACAACTGGTAAGTCTACGCGAGGATTGCGACCGCGCCACGGAGTCTCTGACC
GAAGCAAACAGAAGGCACTGCGGTGGATGCCTTGAGAAAGGGGCTGCTTGACCTGCAAGACGTGTGCGATGTTGT
GGCCAAAGAATACTGGGATAAGAGATGCGCCTTCAACGTCGAAAAGGGTCTGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail