Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04986
Gene name
Locationscaffold_05:2204241..2205807
Strand-
Gene length (bp)1566
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08288 PIGA PIGA (GPI anchor biosynthesis) 1.0E-46 45 134
PF13439 Glyco_transf_4 Glycosyltransferase Family 4 3.7E-27 20 184
PF00534 Glycos_transf_1 Glycosyl transferases group 1 4.7E-26 214 346
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 1.0E-22 219 353
PF13579 Glyco_trans_4_4 Glycosyl transferase 4-like domain 9.8E-11 20 181
PF13477 Glyco_trans_4_2 Glycosyl transferase 4-like 3.0E-05 24 157

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0006506 GPI anchor biosynthetic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0046488 phosphatidylinositol metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016740 transferase activity No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0036211 protein modification process No
GO:0006497 protein lipidation No
GO:0009987 cellular process No
GO:0006643 membrane lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0043412 macromolecule modification No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0044249 cellular biosynthetic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0003674 molecular_function No
GO:0006629 lipid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 429 451 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04986
MARRTYNIAMVSDFFFPQPGGVESHIYQLSSKLIDRGHKVIIITHAHDDRKGIRYLTNGLKVYHVPFFVIYRHTT
FPTVFSFFPVLRNICIRERIEIVHGHGSLSSLCHEGILHARTMGLRTVFTDHSLFGFADAASILTNKLLKFTLSD
VDHSICVSHTCKENTVLRASLDPLMVSVIPNAVVADNFRPRNYPPAPAAPGFNPETSSPTRLGPEDMITIVVISR
LFYNKGTDLLTAAIPRILENHPNTRFIIAGSGPKAIDLEQMIETNVLQDRVEMLGPIRHEEVRDVMVRGHIYLHP
SLTEAFGTVIVEAASCGLYVVCTQVGGIPEVLPTHMTTFAKPEEDDLVQATGKAITAVRAGKVRTDRFHDQVKKM
YSWANVALRTERVYDGISGAIPEEAFYGFDTGGLNGSRVRNFALIDRLKRYYGCGIWAGKLFCLCVVIDYLFFLF
LEWCFPRDRIDVCPDWPRKTLAAAQAEEPAKKMSAGGRHRSSGSHGAVTVSKSEG*
Coding >Ophcf2|04986
ATGGCGCGGCGCACGTACAACATCGCCATGGTCAGCGACTTCTTCTTCCCGCAACCGGGAGGCGTAGAGTCGCAC
ATCTACCAGCTCTCCAGCAAGCTCATCGATCGAGGCCACAAAGTCATCATCATCACGCACGCACACGACGACCGC
AAGGGAATCCGATATCTGACCAACGGGCTCAAAGTCTATCACGTCCCCTTCTTCGTCATCTATCGACACACGACC
TTCCCCACCGTCTTCTCCTTCTTCCCTGTCCTACGAAACATTTGTATCCGGGAGCGGATAGAGATTGTTCATGGG
CACGGGAGTCTTAGTAGTTTGTGTCATGAGGGTATCCTGCATGCTCGGACCATGGGCCTGAGGACTGTTTTTACG
GACCATTCGCTCTTTGGCTTTGCCGACGCTGCCAGCATCTTGACCAACAAGCTTCTCAAGTTTACGCTCAGCGAC
GTCGATCACAGCATCTGCGTGAGCCATACTTGCAAGGAAAACACAGTCCTCCGCGCCTCACTCGACCCCCTGATG
GTCTCCGTCATCCCCAACGCCGTCGTAGCCGACAACTTCCGGCCCCGAAACTATCCCCCCGCCCCAGCAGCCCCC
GGCTTCAACCCAGAAACGTCTTCACCGACGCGTCTCGGTCCGGAAGACATGATCACCATCGTCGTCATCTCCCGC
CTCTTCTACAACAAAGGCACCGATCTCCTCACAGCCGCCATCCCCCGCATCCTAGAGAACCACCCCAACACGCGC
TTCATCATCGCCGGCTCCGGCCCCAAAGCCATCGACCTAGAACAAATGATTGAGACCAACGTACTGCAAGATCGC
GTCGAGATGCTGGGCCCCATCCGCCACGAGGAAGTCCGCGACGTCATGGTCCGCGGCCACATCTACCTACACCCC
TCCCTCACGGAAGCCTTCGGCACCGTCATAGTAGAAGCCGCCAGCTGCGGTCTCTACGTCGTCTGCACCCAGGTA
GGCGGCATACCAGAGGTTCTCCCCACGCACATGACCACCTTCGCCAAGCCCGAAGAAGACGACCTCGTCCAAGCA
ACCGGCAAAGCCATAACCGCCGTCCGAGCCGGCAAAGTCCGCACCGACCGCTTCCACGACCAAGTCAAGAAGATG
TACTCATGGGCCAACGTCGCCCTCCGCACCGAGCGCGTCTACGACGGCATCTCAGGCGCCATCCCCGAGGAGGCC
TTTTACGGCTTCGACACGGGCGGTCTCAACGGCAGCCGCGTTCGTAATTTCGCCCTCATCGATCGACTGAAGCGC
TACTATGGCTGCGGCATCTGGGCTGGTAAGCTGTTTTGTCTCTGCGTTGTCATCGATTACCTCTTTTTCCTCTTT
CTTGAGTGGTGCTTTCCGCGAGACCGTATTGATGTTTGTCCCGATTGGCCGCGGAAGACGTTGGCTGCTGCTCAG
GCTGAGGAGCCGGCGAAGAAGATGTCGGCTGGGGGGCGGCATCGGTCCAGCGGGTCTCATGGCGCCGTCACCGTT
TCCAAGTCAGAGGGTTAG
Transcript >Ophcf2|04986
ATGGCGCGGCGCACGTACAACATCGCCATGGTCAGCGACTTCTTCTTCCCGCAACCGGGAGGCGTAGAGTCGCAC
ATCTACCAGCTCTCCAGCAAGCTCATCGATCGAGGCCACAAAGTCATCATCATCACGCACGCACACGACGACCGC
AAGGGAATCCGATATCTGACCAACGGGCTCAAAGTCTATCACGTCCCCTTCTTCGTCATCTATCGACACACGACC
TTCCCCACCGTCTTCTCCTTCTTCCCTGTCCTACGAAACATTTGTATCCGGGAGCGGATAGAGATTGTTCATGGG
CACGGGAGTCTTAGTAGTTTGTGTCATGAGGGTATCCTGCATGCTCGGACCATGGGCCTGAGGACTGTTTTTACG
GACCATTCGCTCTTTGGCTTTGCCGACGCTGCCAGCATCTTGACCAACAAGCTTCTCAAGTTTACGCTCAGCGAC
GTCGATCACAGCATCTGCGTGAGCCATACTTGCAAGGAAAACACAGTCCTCCGCGCCTCACTCGACCCCCTGATG
GTCTCCGTCATCCCCAACGCCGTCGTAGCCGACAACTTCCGGCCCCGAAACTATCCCCCCGCCCCAGCAGCCCCC
GGCTTCAACCCAGAAACGTCTTCACCGACGCGTCTCGGTCCGGAAGACATGATCACCATCGTCGTCATCTCCCGC
CTCTTCTACAACAAAGGCACCGATCTCCTCACAGCCGCCATCCCCCGCATCCTAGAGAACCACCCCAACACGCGC
TTCATCATCGCCGGCTCCGGCCCCAAAGCCATCGACCTAGAACAAATGATTGAGACCAACGTACTGCAAGATCGC
GTCGAGATGCTGGGCCCCATCCGCCACGAGGAAGTCCGCGACGTCATGGTCCGCGGCCACATCTACCTACACCCC
TCCCTCACGGAAGCCTTCGGCACCGTCATAGTAGAAGCCGCCAGCTGCGGTCTCTACGTCGTCTGCACCCAGGTA
GGCGGCATACCAGAGGTTCTCCCCACGCACATGACCACCTTCGCCAAGCCCGAAGAAGACGACCTCGTCCAAGCA
ACCGGCAAAGCCATAACCGCCGTCCGAGCCGGCAAAGTCCGCACCGACCGCTTCCACGACCAAGTCAAGAAGATG
TACTCATGGGCCAACGTCGCCCTCCGCACCGAGCGCGTCTACGACGGCATCTCAGGCGCCATCCCCGAGGAGGCC
TTTTACGGCTTCGACACGGGCGGTCTCAACGGCAGCCGCGTTCGTAATTTCGCCCTCATCGATCGACTGAAGCGC
TACTATGGCTGCGGCATCTGGGCTGGTAAGCTGTTTTGTCTCTGCGTTGTCATCGATTACCTCTTTTTCCTCTTT
CTTGAGTGGTGCTTTCCGCGAGACCGTATTGATGTTTGTCCCGATTGGCCGCGGAAGACGTTGGCTGCTGCTCAG
GCTGAGGAGCCGGCGAAGAAGATGTCGGCTGGGGGGCGGCATCGGTCCAGCGGGTCTCATGGCGCCGTCACCGTT
TCCAAGTCAGAGGGTTAG
Gene >Ophcf2|04986
ATGGCGCGGCGCACGTACAACATCGCCATGGTCAGCGACTTCTTCTTCCCGCAACCGGGAGGCGTAGAGTCGCAC
ATCTACCAGCTCTCCAGCAAGCTCATCGATCGAGGCCACAAAGTCATCATCATCACGCACGCACACGACGACCGC
AAGGGAATCCGATATCTGACCAACGGGCTCAAAGTCTATCACGTCCCCTTCTTCGTCATCTATCGACACACGACC
TTCCCCACCGTCTTCTCCTTCTTCCCTGTCCTACGAAACATTTGTATCCGGGAGCGGATAGAGATTGTTCATGGG
CACGGGAGTCTTAGTAGTTTGTGTCATGAGGGTATCCTGCATGCTCGGACCATGGGCCTGAGGACTGTTTTTACG
GACCATTCGCTCTTTGGCTTTGCCGACGCTGCCAGCATCTTGACCAACAAGCTTCTCAAGTTTACGCTCAGCGAC
GTCGATCACAGCATCTGCGTGAGCCATACTTGGTTCGCCTCTTACTCCTCTCTTTCGAAGAAGCAGCTGACTCTT
CTCAGCAAGGAAAACACAGTCCTCCGCGCCTCACTCGACCCCCTGATGGTCTCCGTCATCCCCAACGCCGTCGTA
GCCGACAACTTCCGGCCCCGAAACTATCCCCCCGCCCCAGCAGCCCCCGGCTTCAACCCAGAAACGTCTTCACCG
ACGCGTCTCGGTCCGGAAGACATGATCACCATCGTCGTCATCTCCCGCCTCTTCTACAACAAAGGCACCGATCTC
CTCACAGCCGCCATCCCCCGCATCCTAGAGAACCACCCCAACACGCGCTTCATCATCGCCGGCTCCGGCCCCAAA
GCCATCGACCTAGAACAAATGATTGAGACCAACGTACTGCAAGATCGCGTCGAGATGCTGGGCCCCATCCGCCAC
GAGGAAGTCCGCGACGTCATGGTCCGCGGCCACATCTACCTACACCCCTCCCTCACGGAAGCCTTCGGCACCGTC
ATAGTAGAAGCCGCCAGCTGCGGTCTCTACGTCGTCTGCACCCAGGTAGGCGGCATACCAGAGGTTCTCCCCACG
CACATGACCACCTTCGCCAAGCCCGAAGAAGACGACCTCGTCCAAGCAACCGGCAAAGCCATAACCGCCGTCCGA
GCCGGCAAAGTCCGCACCGACCGCTTCCACGACCAAGTCAAGAAGATGTACTCATGGGCCAACGTCGCCCTCCGC
ACCGAGCGCGTCTACGACGGCATCTCAGGCGCCATCCCCGAGGAGGCCTTTTACGGCTTCGACACGGGCGGTCTC
AACGGCAGCCGCGTTCGTAATTTCGCCCTCATCGATCGACTGAAGCGCTACTATGGCTGCGGCATCTGGGCTGGT
AAGCTGTTTTGTCTCTGCGTTGTCATCGATTACCTCTTTTTCCTCTTTCTTGAGTGGTGCTTTCCGCGAGACCGT
ATTGATGTTTGTCCCGATTGGCCGCGGAAGACGTTGGCTGCTGCTCAGGCTGAGGAGCCGGCGAAGAAGATGTCG
GCTGGGGGGCGGCATCGGTCCAGCGGGTCTCATGGCGCCGTCACCGTTTCCAAGTCAGAGGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail