Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04982
Gene name
Locationscaffold_05:2189339..2190064
Strand+
Gene length (bp)725
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04387 PTPLA Protein tyrosine phosphatase-like protein, PTPLA 5.4E-55 50 194

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 51 73 22
3 80 99 19
4 114 132 18
5 137 155 18
6 165 182 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04982
MASKTAYLVLFNLASAAAWAVVLSRTVAISALSGPTFTYGGVGMWTKWTQTLAVFEVLHSLLGVVRAPLFTTLMQ
VSSRFLLVWAIINRFPFLALSPAYSSMLVAWSTTEVIRYSYFALNLSGFSPAFLTWLRYSTFWVLYPIGILSECT
LIFMASAHCQPVERYALYAILAIYVPGSYVLYTHMMSQRRKVMSSAKNKKGD*
Coding >Ophcf2|04982
ATGGCCTCTAAGACGGCCTACCTCGTTCTCTTCAACCTGGCCTCGGCCGCTGCCTGGGCCGTTGTCCTGAGCCGT
ACCGTCGCCATCTCCGCCCTGTCCGGTCCGACCTTTACATATGGCGGCGTCGGTATGTGGACGAAGTGGACGCAG
ACGCTCGCCGTCTTTGAGGTGCTGCACTCGCTGCTCGGCGTCGTTCGGGCCCCCCTCTTCACTACCCTGATGCAG
GTCTCGTCGCGCTTCCTCCTCGTCTGGGCCATCATCAACCGCTTTCCCTTCCTGGCTCTCTCGCCCGCGTACTCT
TCCATGCTGGTGGCTTGGTCGACGACCGAGGTTATCCGCTACTCCTACTTCGCCCTCAACCTATCCGGCTTCTCG
CCCGCTTTCCTTACTTGGCTGCGCTACAGCACCTTTTGGGTCTTGTACCCGATTGGCATCCTCAGCGAGTGTACT
CTCATCTTTATGGCCTCGGCTCACTGCCAGCCTGTTGAGCGGTACGCTCTTTACGCTATTCTGGCTATCTATGTG
CCTGGCTCTTATGTCCTCTACACGCACATGATGTCGCAGCGGAGAAAGGTCATGAGCTCTGCCAAGAACAAAAAG
GGCGACTGA
Transcript >Ophcf2|04982
ATGGCCTCTAAGACGGCCTACCTCGTTCTCTTCAACCTGGCCTCGGCCGCTGCCTGGGCCGTTGTCCTGAGCCGT
ACCGTCGCCATCTCCGCCCTGTCCGGTCCGACCTTTACATATGGCGGCGTCGGTATGTGGACGAAGTGGACGCAG
ACGCTCGCCGTCTTTGAGGTGCTGCACTCGCTGCTCGGCGTCGTTCGGGCCCCCCTCTTCACTACCCTGATGCAG
GTCTCGTCGCGCTTCCTCCTCGTCTGGGCCATCATCAACCGCTTTCCCTTCCTGGCTCTCTCGCCCGCGTACTCT
TCCATGCTGGTGGCTTGGTCGACGACCGAGGTTATCCGCTACTCCTACTTCGCCCTCAACCTATCCGGCTTCTCG
CCCGCTTTCCTTACTTGGCTGCGCTACAGCACCTTTTGGGTCTTGTACCCGATTGGCATCCTCAGCGAGTGTACT
CTCATCTTTATGGCCTCGGCTCACTGCCAGCCTGTTGAGCGGTACGCTCTTTACGCTATTCTGGCTATCTATGTG
CCTGGCTCTTATGTCCTCTACACGCACATGATGTCGCAGCGGAGAAAGGTCATGAGCTCTGCCAAGAACAAAAAG
GGCGACTGA
Gene >Ophcf2|04982
ATGGCCTCTAAGACGGCCTACCTCGTTCTCTTCAACCTGGCCTCGGCCGCTGCCTGGGCCGTTGTCCTGAGCCGT
ACCGTCGCCATCTCCGCCCTGTCCGGTCCGACCTTTACATATGGCGGCGTCGGTATGTGGACGAAGTGGACGCAG
ACGCTCGCCGTCTTTGAGGTGCTGCACTCGCTGCTCGGTTTGATTTCCCTTTTCAGTCATAGTCACGTATACCAA
AGTTTAGCTGATCCTTTCCCTAGGCGTCGTTCGGGCCCCCCTCTTCACTACCCTGATGCAGGTCTCGTCGCGCTT
CCTCCTCGTCTGGGCCATCATCAACCGCTTTCCCTTCCTGGCTCTCTCGCCCGCGTACTCTTCCATGCTGGTGGC
TTGGTCGACGACCGAGGTTATCCGCTACTCCTACTTCGCCCTCAACCTATCCGGCTTCTCGCCCGCTTTCCTTAC
TTGGCTGCGCTACAGCACCTTTTGGGTCTTGTACCCGATTGGCATCCTCAGCGAGTGTACTCTCATCTTTATGGC
CTCGGCTCACTGCCAGCCTGTTGAGCGGTACGCTCTTTACGCTATTCTGGCTATCTATGTGCCTGGTATGTTGGC
GTTTTCTTGCCAGTTGTTGTGTTTGTTTCTGACGAGCCTTTACAGGCTCTTATGTCCTCTACACGCACATGATGT
CGCAGCGGAGAAAGGTCATGAGCTCTGCCAAGAACAAAAAGGGCGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail