Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04975
Gene name
Locationscaffold_05:2129382..2131189
Strand+
Gene length (bp)1807
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09994 DUF2235 Uncharacterized alpha/beta hydrolase domain (DUF2235) 2.6E-78 9 309

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6679 0.4212 0.1847 0.2898 0.1602 0.0924 0.0584 0.1947 0.0838 0.1018

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6561
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04975 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5575
Ophiocordyceps kimflemingae Ophio5|578
Ophiocordyceps subramaniannii Hirsu2|2408

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04975
MAMTAGVKKRLIVCCDGTWMNSAYGYVKPGLLGGRGGLQVPSNVTRISRCFKRRCSDGTLQIINYESGVGSGSNV
LDSITGGAFGVGLAERVREAYSFLCSNYRDGDEMILIGFSRGAFTARSVAGLLANLGLLTREGVEHFYPIFKDMQ
NWHNGDYRDPFPSVPFPEKPRGPNAAAVYRERLVKRGYTRVHQQNGALITVKAICVWDTVGSLGIPRIAWLDKMG
VRPDNEEYKWHDTALSDRIEHAFQALALDETRAPFSPALWERPRQANMATVLKQVWFPGNHSNCGGGWGDQGIAN
CTLAWMMDQMASVGVEFDIESLDRVIQRSNDYYLNATRKHDCRPRRRRKLRQWAVDAIYHANQPVRPWGLGAMQR
DSSLLFKLSGFMTRTPGVYKQVHPKTRLDMSQFLHDTNETVHSSVRVRLACGGLGLNDETVWSCAALSSWRLKRV
RVMPPPSSDSGKGSVESDEEMETRWIWKYVGDELDAPADPSQRTMREEPLGPYERYLLDKSGGFPNVLGFADGGC
DWGRKRISNFPGVMMK*
Coding >Ophcf2|04975
ATGGCCATGACGGCAGGCGTCAAGAAACGGCTCATCGTCTGCTGCGACGGAACATGGATGAACAGCGCGTACGGT
TACGTCAAGCCCGGCCTGCTCGGTGGCCGCGGTGGACTCCAGGTGCCGTCCAACGTGACACGGATATCGCGCTGC
TTCAAGCGCCGCTGTAGCGACGGCACGCTGCAGATCATCAACTACGAGTCGGGCGTCGGCAGTGGGAGCAACGTG
CTGGATAGCATCACGGGCGGTGCCTTTGGCGTCGGCCTGGCCGAGCGAGTCCGAGAGGCATACTCCTTTCTCTGT
TCCAACTATCGCGACGGTGACGAGATGATTCTCATCGGCTTCTCCCGCGGTGCCTTTACTGCGCGTTCTGTCGCT
GGCCTCCTCGCCAACCTCGGTCTATTGACGCGCGAGGGCGTCGAGCACTTTTATCCCATCTTCAAAGACATGCAG
AACTGGCATAATGGAGACTACCGCGACCCCTTTCCCTCTGTGCCCTTCCCGGAGAAGCCTCGCGGGCCCAACGCG
GCGGCTGTGTATCGCGAGCGTCTCGTCAAGCGGGGATACACGCGTGTCCATCAGCAAAACGGCGCCCTCATCACC
GTAAAGGCCATATGCGTGTGGGACACGGTCGGTAGTCTGGGCATCCCCCGTATAGCCTGGCTCGACAAGATGGGT
GTTCGTCCGGACAACGAAGAGTACAAGTGGCACGACACGGCCTTGTCCGATAGGATAGAGCACGCCTTCCAGGCC
CTTGCGCTCGACGAGACGCGCGCTCCTTTCAGTCCTGCTCTTTGGGAGCGTCCGCGGCAGGCCAATATGGCGACG
GTCCTGAAGCAAGTCTGGTTCCCGGGGAACCACAGCAACTGCGGCGGCGGATGGGGCGATCAGGGTATCGCCAAC
TGCACCTTGGCCTGGATGATGGACCAGATGGCCAGCGTCGGAGTCGAGTTCGACATTGAATCTCTCGACCGCGTC
ATCCAAAGGTCCAACGACTACTACCTCAACGCCACCCGCAAGCACGACTGCAGGCCACGACGACGACGAAAGCTA
CGGCAATGGGCCGTCGACGCCATCTACCACGCAAACCAACCCGTACGACCCTGGGGCCTGGGCGCCATGCAGCGT
GACTCAAGCCTCCTGTTCAAACTCTCAGGCTTCATGACGCGAACGCCGGGCGTGTACAAGCAAGTCCACCCCAAG
ACGCGACTAGACATGAGCCAGTTCCTCCACGACACCAACGAGACGGTCCACAGCTCGGTACGAGTCCGTCTCGCG
TGTGGCGGCCTCGGCCTCAACGATGAGACCGTCTGGTCATGTGCCGCGCTGTCCAGCTGGCGTCTCAAACGAGTG
CGCGTCATGCCACCCCCATCAAGCGACAGCGGCAAGGGGAGCGTCGAATCTGACGAAGAGATGGAGACGCGTTGG
ATCTGGAAGTATGTCGGTGATGAGCTTGACGCTCCTGCTGATCCGAGTCAGAGGACGATGCGGGAGGAGCCGCTG
GGGCCGTATGAGAGGTATCTGCTCGACAAGTCGGGGGGGTTCCCCAACGTCTTGGGCTTTGCAGATGGGGGGTGT
GATTGGGGGCGGAAGAGGATCTCGAACTTTCCGGGGGTGATGATGAAGTGA
Transcript >Ophcf2|04975
ATGGCCATGACGGCAGGCGTCAAGAAACGGCTCATCGTCTGCTGCGACGGAACATGGATGAACAGCGCGTACGGT
TACGTCAAGCCCGGCCTGCTCGGTGGCCGCGGTGGACTCCAGGTGCCGTCCAACGTGACACGGATATCGCGCTGC
TTCAAGCGCCGCTGTAGCGACGGCACGCTGCAGATCATCAACTACGAGTCGGGCGTCGGCAGTGGGAGCAACGTG
CTGGATAGCATCACGGGCGGTGCCTTTGGCGTCGGCCTGGCCGAGCGAGTCCGAGAGGCATACTCCTTTCTCTGT
TCCAACTATCGCGACGGTGACGAGATGATTCTCATCGGCTTCTCCCGCGGTGCCTTTACTGCGCGTTCTGTCGCT
GGCCTCCTCGCCAACCTCGGTCTATTGACGCGCGAGGGCGTCGAGCACTTTTATCCCATCTTCAAAGACATGCAG
AACTGGCATAATGGAGACTACCGCGACCCCTTTCCCTCTGTGCCCTTCCCGGAGAAGCCTCGCGGGCCCAACGCG
GCGGCTGTGTATCGCGAGCGTCTCGTCAAGCGGGGATACACGCGTGTCCATCAGCAAAACGGCGCCCTCATCACC
GTAAAGGCCATATGCGTGTGGGACACGGTCGGTAGTCTGGGCATCCCCCGTATAGCCTGGCTCGACAAGATGGGT
GTTCGTCCGGACAACGAAGAGTACAAGTGGCACGACACGGCCTTGTCCGATAGGATAGAGCACGCCTTCCAGGCC
CTTGCGCTCGACGAGACGCGCGCTCCTTTCAGTCCTGCTCTTTGGGAGCGTCCGCGGCAGGCCAATATGGCGACG
GTCCTGAAGCAAGTCTGGTTCCCGGGGAACCACAGCAACTGCGGCGGCGGATGGGGCGATCAGGGTATCGCCAAC
TGCACCTTGGCCTGGATGATGGACCAGATGGCCAGCGTCGGAGTCGAGTTCGACATTGAATCTCTCGACCGCGTC
ATCCAAAGGTCCAACGACTACTACCTCAACGCCACCCGCAAGCACGACTGCAGGCCACGACGACGACGAAAGCTA
CGGCAATGGGCCGTCGACGCCATCTACCACGCAAACCAACCCGTACGACCCTGGGGCCTGGGCGCCATGCAGCGT
GACTCAAGCCTCCTGTTCAAACTCTCAGGCTTCATGACGCGAACGCCGGGCGTGTACAAGCAAGTCCACCCCAAG
ACGCGACTAGACATGAGCCAGTTCCTCCACGACACCAACGAGACGGTCCACAGCTCGGTACGAGTCCGTCTCGCG
TGTGGCGGCCTCGGCCTCAACGATGAGACCGTCTGGTCATGTGCCGCGCTGTCCAGCTGGCGTCTCAAACGAGTG
CGCGTCATGCCACCCCCATCAAGCGACAGCGGCAAGGGGAGCGTCGAATCTGACGAAGAGATGGAGACGCGTTGG
ATCTGGAAGTATGTCGGTGATGAGCTTGACGCTCCTGCTGATCCGAGTCAGAGGACGATGCGGGAGGAGCCGCTG
GGGCCGTATGAGAGGTATCTGCTCGACAAGTCGGGGGGGTTCCCCAACGTCTTGGGCTTTGCAGATGGGGGGTGT
GATTGGGGGCGGAAGAGGATCTCGAACTTTCCGGGGGTGATGATGAAGTGA
Gene >Ophcf2|04975
ATGGCCATGACGGCAGGCGTCAAGAAACGGCTCATCGTCTGCTGCGACGGAACATGGATGAACAGCGCGTACGGT
TACGTCAAGCCCGGCCTGCTCGGTGGCCGCGGTGGACTCCAGGTGCCGTCCAACGTGACACGGATATCGCGCTGC
TTCAAGCGCCGCTGTAGCGACGGCACGCTGCAGATCATCAACTACGAGTCGGGCGTCGGCAGTGGGAGCAACGTG
CTGGATAGCATCACGGGCGGTGCCTTTGGCGTCGGCCTGGCCGAGGTTTGTCTGGCGTCTTTGCCGTGTCTTGTC
GGGGGAGGTCCGACTGAGATTTTGTTCACGGCCATTAGCGAGTCCGAGAGGCATACTCCTTTCTCTGTTCCAACT
ATCGCGACGGTGACGAGATGATTCTCATCGGCTTCTCCCGCGGTGCCTTTACTGCGCGTTCTGTCGCTGGCCTCC
TCGCCAACCTCGGTCTATTGACGCGCGAGGGCGTCGAGCACTTTTATCCCATCTTCAAAGACATGCAGAACTGGC
ATAATGGAGACTACCGCGACCCCTTTCCCTCTGTGCCCTTCCCGGAGAAGCCTCGCGGGCCCAACGCGGCGGCTG
TGTATCGCGAGCGTCTCGTCAAGCGGGGATACACGCGTGTCCATCAGCAAAACGGCGCCCTCATCACCGTAAAGG
CCATATGCGTGTGGGACACGGTCGGTAGTCTGGGCATCCCCCGTATAGCCTGGCTCGACAAGATGGGTGTTCGTC
CGGACAACGAAGAATAAGTCGCCTCCCAGCAGCTATGGTCTTGGTTCGTACTGACCGTCGAAAACGTACAAGTGG
CACGACACGGCCTTGTCCGATAGGATAGAGCACGCCTTCCAGGCCCTTGCGCTCGACGAGACGCGCGCTCCTTTC
AGTCCTGCTCTTTGGGAGCGTCCGCGGCAGGCCAATATGGCGACGGTCCTGAAGCAAGTCTGGTTCCCGGGGAAC
CACAGCAACTGCGGCGGCGGATGGGGCGATCAGGGTATCGCCAACTGCACCTTGGCCTGTACGTGTTGGAGAGCC
TGGGGGACGATGGATGAGGCGGTCGAGTTGATGGGTTTACGCAGGGATGATGGACCAGATGGCCAGCGTCGGAGT
CGAGTTCGACATTGAATCTCTCGACCGCGTCATCCAAAGGTCCAACGACTACTACCTCAACGCCACCCGCAAGCA
CGACTGCAGGCCACGACGACGACGAAAGCTACGGCAATGGGCCGTCGACGCCATCTACCACGCAAACCAACCCGT
ACGACCCTGGGGCCTGGGCGCCATGCAGCGTGACTCAAGCCTCCTGTTCAAACTCTCAGGCTTCATGACGCGAAC
GCCGGGCGTGTACAAGCAAGTCCACCCCAAGACGCGACTAGACATGAGCCAGTTCCTCCACGACACCAACGAGAC
GGTCCACAGCTCGGTACGAGTCCGTCTCGCGTGTGGCGGCCTCGGCCTCAACGATGAGACCGTCTGGTCATGTGC
CGCGCTGTCCAGCTGGCGTCTCAAACGAGTGCGCGTCATGCCACCCCCATCAAGCGACAGCGGCAAGGGGAGCGT
CGAATCTGACGAAGAGATGGAGACGCGTTGGATCTGGAAGTATGTCGGTGATGAGCTTGACGCTCCTGCTGATCC
GAGTCAGAGGACGATGCGGGAGGAGCCGCTGGGGCCGTATGAGAGGTATCTGCTCGACAAGTCGGGGGGGTTCCC
CAACGTCTTGGGCTTTGCAGATGGGGGGTGTGATTGGGGGCGGAAGAGGATCTCGAACTTTCCGGGGGTGATGAT
GAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail