Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04958
Gene name
Locationscaffold_05:2095591..2096627
Strand+
Gene length (bp)1036
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10615 DUF2470 Domain of unknown function (DUF2470) 2.6E-15 92 164

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.2685 0.3299 0.2609 0.0724 0.1984 0.1911 0.6147 0.3016 0.2067 0.0458

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2041
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2089
Ophiocordyceps australis map64 (Brazil) OphauB2|7479
Ophiocordyceps camponoti-floridani Ophcf2|04958 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5591
Ophiocordyceps kimflemingae Ophio5|6110
Ophiocordyceps subramaniannii Hirsu2|233

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04958
MSHDSPSLGPAPALVILPSTNGSIASDEKKKKKKQRQRGREEAFKTTASRSWLNESLTPLPWLHDSSRIPPRLRQ
HTTKMAASTQADEEARDRVMRHMNQSHTRELSHLVRHSSGASVSEAANPSLRDLTLQGMRVRAGGNEYAVAFSPA
LGDWSEARHRIIAMDAEARRGLGISDVYVTRYVPPRPGLERIVVFYVFLYIVCRLTLPYIEPGSGVWAFIDAVFP
GGFSSYTAVVRFITLPMFAVHSLETIVFDRKLRSHGIDRWSGLWWKWSLDCFVEGVCAFRKLNHIVAETRAAKKQ
SQM*
Coding >Ophcf2|04958
ATGAGTCATGACAGTCCGTCCCTCGGCCCCGCCCCCGCCCTAGTGATATTACCGAGTACCAACGGATCAATAGCC
AGTGACGAGAAAAAGAAAAAAAAGAAGCAGAGACAGAGAGGGAGAGAAGAGGCCTTCAAGACGACAGCTTCTCGC
TCTTGGCTAAACGAAAGCCTCACACCTCTCCCTTGGCTCCACGACAGCAGCCGCATTCCTCCCAGACTGAGACAG
CACACAACGAAGATGGCGGCCTCCACGCAAGCCGATGAAGAGGCCCGAGATCGCGTCATGCGCCACATGAACCAG
TCACACACCCGCGAGCTCTCCCATCTGGTCCGTCACTCCAGCGGCGCGTCTGTATCCGAGGCGGCCAACCCTTCG
CTGCGCGATTTGACGCTGCAGGGCATGAGGGTTCGAGCTGGAGGAAACGAATACGCTGTTGCTTTCTCGCCCGCT
CTCGGCGACTGGTCAGAGGCCCGCCATCGAATCATAGCCATGGACGCCGAGGCTCGTCGGGGCCTCGGCATCAGC
GACGTCTACGTGACACGTTACGTTCCCCCTCGTCCTGGTTTGGAGCGCATCGTCGTCTTCTACGTCTTCTTATAC
ATCGTCTGTCGCCTCACATTGCCCTATATCGAGCCCGGCTCTGGAGTCTGGGCCTTCATTGACGCCGTCTTCCCG
GGCGGCTTCTCGTCGTATACGGCCGTCGTCCGCTTCATCACTCTGCCCATGTTCGCCGTTCACTCCCTCGAGACG
ATCGTCTTTGATCGCAAGCTACGCAGCCATGGCATCGACCGCTGGTCTGGCCTGTGGTGGAAGTGGTCTCTCGAC
TGCTTCGTCGAGGGCGTCTGCGCCTTTCGGAAACTAAATCACATCGTAGCCGAGACGAGGGCGGCCAAGAAACAA
TCCCAAATGTAG
Transcript >Ophcf2|04958
ATGAGTCATGACAGTCCGTCCCTCGGCCCCGCCCCCGCCCTAGTGATATTACCGAGTACCAACGGATCAATAGCC
AGTGACGAGAAAAAGAAAAAAAAGAAGCAGAGACAGAGAGGGAGAGAAGAGGCCTTCAAGACGACAGCTTCTCGC
TCTTGGCTAAACGAAAGCCTCACACCTCTCCCTTGGCTCCACGACAGCAGCCGCATTCCTCCCAGACTGAGACAG
CACACAACGAAGATGGCGGCCTCCACGCAAGCCGATGAAGAGGCCCGAGATCGCGTCATGCGCCACATGAACCAG
TCACACACCCGCGAGCTCTCCCATCTGGTCCGTCACTCCAGCGGCGCGTCTGTATCCGAGGCGGCCAACCCTTCG
CTGCGCGATTTGACGCTGCAGGGCATGAGGGTTCGAGCTGGAGGAAACGAATACGCTGTTGCTTTCTCGCCCGCT
CTCGGCGACTGGTCAGAGGCCCGCCATCGAATCATAGCCATGGACGCCGAGGCTCGTCGGGGCCTCGGCATCAGC
GACGTCTACGTGACACGTTACGTTCCCCCTCGTCCTGGTTTGGAGCGCATCGTCGTCTTCTACGTCTTCTTATAC
ATCGTCTGTCGCCTCACATTGCCCTATATCGAGCCCGGCTCTGGAGTCTGGGCCTTCATTGACGCCGTCTTCCCG
GGCGGCTTCTCGTCGTATACGGCCGTCGTCCGCTTCATCACTCTGCCCATGTTCGCCGTTCACTCCCTCGAGACG
ATCGTCTTTGATCGCAAGCTACGCAGCCATGGCATCGACCGCTGGTCTGGCCTGTGGTGGAAGTGGTCTCTCGAC
TGCTTCGTCGAGGGCGTCTGCGCCTTTCGGAAACTAAATCACATCGTAGCCGAGACGAGGGCGGCCAAGAAACAA
TCCCAAATGTAG
Gene >Ophcf2|04958
ATGAGTCATGACAGTCCGTCCCTCGGCCCCGCCCCCGCCCTAGTGATATTACCGAGTACCAACGGATCAATAGCC
AGTGACGAGAAAAAGAAAAAAAAGAAGCAGAGACAGGTGAGAGAAAGAGAGACAAGGGGAAGAGAGATTGAGAGA
AAGAGGGAGAGAGACAGACAGACAGAGAGGGAGAGAAGAGGCCTTCAAGGTAATGGCTGTCTGTCTTCCCCGAGA
GACGGCCAAAATCTTACCCCCTTTGCCGCAAAAGACGACAGCTTCTCGCTCTTGGCTAAACGAAAGCCTCACACC
TCTCCCTTGGCTCCACGACAGCAGCCGCATTCCTCCCAGACTGAGACAGCACACAACGAAGATGGCGGCCTCCAC
GCAAGCCGATGAAGAGGCCCGAGATCGCGTCATGCGCCACATGAACCAGTCACACACCCGCGAGCTCTCCCATCT
GGTCCGTCACTCCAGCGGCGCGTCTGTATCCGAGGCGGCCAACCCTTCGCTGCGCGATTTGACGCTGCAGGGCAT
GAGGGTTCGAGCTGGAGGAAACGAATACGCTGTTGCTTTCTCGCCCGCTCTCGGCGACTGGTCAGAGGCCCGCCA
TCGAATCATAGCCATGGACGCCGAGGCTCGTCGGGGCCTCGGCATCAGCGACGTCTACGTGACACGTTACGTTCC
CCCTCGTCCTGGTTTGGAGCGCATCGTCGTCTTCTACGTCTTCTTATACATCGTCTGTCGCCTCACATTGCCCTA
TATCGAGCCCGGCTCTGGAGTCTGGGCCTTCATTGACGCCGTCTTCCCGGGCGGCTTCTCGTCGTATACGGCCGT
CGTCCGCTTCATCACTCTGCCCATGTTCGCCGTTCACTCCCTCGAGACGATCGTCTTTGATCGCAAGCTACGCAG
CCATGGCATCGACCGCTGGTCTGGCCTGTGGTGGAAGTGGTCTCTCGACTGCTTCGTCGAGGGCGTCTGCGCCTT
TCGGAAACTAAATCACATCGTAGCCGAGACGAGGGCGGCCAAGAAACAATCCCAAATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail