Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04954
Gene name
Locationscaffold_05:2064521..2065213
Strand+
Gene length (bp)692
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1672 0.0506 0.7674 0.0961 0.1415 0.0454 0.4542 0.2226 0.2797 0.0106

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1542
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7854
Ophiocordyceps australis map64 (Brazil) OphauB2|7470
Ophiocordyceps camponoti-floridani Ophcf2|04954 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5595
Ophiocordyceps kimflemingae Ophio5|6114
Ophiocordyceps subramaniannii Hirsu2|11253

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04954
MRASLVSSSPALASIAIALAADAVLAHGGSDAQKPIVDDSAKTDWMTRHMAEEHHITTWDAESFFSLHDYNADGI
WQVDEIQRTYGLLDPSNKDVSHERKEQVTRDLLALLDTDADSTVTLAEWKAFLAKGKTLPDMGTGPGHHGDDEYE
YEMHHWAKYHDENTKLEDLTHPEDIEHFKKHEEEEKAAEAQQALDQKSIVEENIPSKFRRRN*
Coding >Ophcf2|04954
ATGCGTGCCTCCCTCGTCTCTTCGTCCCCGGCCCTCGCCAGCATTGCCATCGCTCTCGCCGCTGACGCCGTCCTC
GCTCATGGCGGGAGCGACGCGCAGAAGCCCATTGTCGACGACTCGGCCAAGACGGACTGGATGACTAGACACATG
GCAGAGGAGCACCACATCACCACCTGGGACGCCGAATCCTTCTTCAGCCTGCACGACTACAACGCCGACGGCATC
TGGCAGGTCGACGAGATACAGCGCACCTACGGCCTCCTAGACCCCTCCAACAAAGACGTCTCGCACGAGCGAAAG
GAGCAGGTCACGCGCGACCTGCTGGCCCTCCTCGACACCGACGCCGACTCGACCGTCACCCTGGCCGAATGGAAG
GCCTTCCTCGCCAAGGGCAAGACGCTGCCGGACATGGGCACCGGCCCCGGCCACCACGGCGACGACGAGTACGAG
TACGAGATGCACCATTGGGCAAAGTATCATGATGAAAACACCAAGCTCGAGGACTTGACCCATCCCGAGGACATT
GAGCACTTCAAGAAGCATGAAGAGGAGGAAAAGGCCGCCGAGGCGCAACAGGCTCTTGATCAAAAGTCCATTGTC
GAGGAGAACATACCGTCCAAGTTTCGTCGGCGGAACTGA
Transcript >Ophcf2|04954
ATGCGTGCCTCCCTCGTCTCTTCGTCCCCGGCCCTCGCCAGCATTGCCATCGCTCTCGCCGCTGACGCCGTCCTC
GCTCATGGCGGGAGCGACGCGCAGAAGCCCATTGTCGACGACTCGGCCAAGACGGACTGGATGACTAGACACATG
GCAGAGGAGCACCACATCACCACCTGGGACGCCGAATCCTTCTTCAGCCTGCACGACTACAACGCCGACGGCATC
TGGCAGGTCGACGAGATACAGCGCACCTACGGCCTCCTAGACCCCTCCAACAAAGACGTCTCGCACGAGCGAAAG
GAGCAGGTCACGCGCGACCTGCTGGCCCTCCTCGACACCGACGCCGACTCGACCGTCACCCTGGCCGAATGGAAG
GCCTTCCTCGCCAAGGGCAAGACGCTGCCGGACATGGGCACCGGCCCCGGCCACCACGGCGACGACGAGTACGAG
TACGAGATGCACCATTGGGCAAAGTATCATGATGAAAACACCAAGCTCGAGGACTTGACCCATCCCGAGGACATT
GAGCACTTCAAGAAGCATGAAGAGGAGGAAAAGGCCGCCGAGGCGCAACAGGCTCTTGATCAAAAGTCCATTGTC
GAGGAGAACATACCGTCCAAGTTTCGTCGGCGGAACTGA
Gene >Ophcf2|04954
ATGCGTGCCTCCCTCGTCTCTTCGTCCCCGGCCCTCGCCAGCATTGCCATCGCTCTCGCCGCTGACGCCGTCCTC
GCTCATGGCGGGAGCGACGCGCAGAAGCCCATTGTCGACGACTCGGCCAAGACGGACTGGATGACTAGACACATG
GCAGGCATGTCTCCTCCGCTCCACTCTCCACTCTCCCTCCCCTTACCTTTCCCGCAGAGGAGCACCACATCACCA
CCTGGGACGCCGAATCCTTCTTCAGCCTGCACGACTACAACGCCGACGGCATCTGGCAGGTCGACGAGATACAGC
GCACCTACGGCCTCCTAGACCCCTCCAACAAAGACGTCTCGCACGAGCGAAAGGAGCAGGTCACGCGCGACCTGC
TGGCCCTCCTCGACACCGACGCCGACTCGACCGTCACCCTGGCCGAATGGAAGGCCTTCCTCGCCAAGGGCAAGA
CGCTGCCGGACATGGGCACCGGCCCCGGCCACCACGGCGACGACGAGTACGAGTACGAGATGCACCATTGGGCAA
AGTATCATGATGAAAACACCAAGCTCGAGGACTTGACCCATCCCGAGGACATTGAGCACTTCAAGAAGCATGAAG
AGGAGGAAAAGGCCGCCGAGGCGCAACAGGCTCTTGATCAAAAGTCCATTGTCGAGGAGAACATACCGTCCAAGT
TTCGTCGGCGGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail