Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04952
Gene name
Locationscaffold_05:2061610..2062882
Strand+
Gene length (bp)1272
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00775 Dioxygenase_C Dioxygenase 1.0E-09 130 226

GO

GO Term Description Terminal node
GO:0006725 cellular aromatic compound metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008199 ferric iron binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0008152 metabolic process No
GO:0005506 iron ion binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0044237 cellular metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1927 0.0567 0.928 0.123 0.0738 0.0172 0.3209 0.3286 0.272 0.0013

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999773

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup690
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3659
Ophiocordyceps australis map64 (Brazil) OphauB2|311
Ophiocordyceps australis map64 (Brazil) OphauB2|7726
Ophiocordyceps camponoti-floridani Ophcf2|04952 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5597
Ophiocordyceps kimflemingae Ophio5|6116
Ophiocordyceps subramaniannii Hirsu2|11255

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04952
MARFSCALALALFFALLVDAHPKTGEEMERALRLRSVVTERSRTALDRCSGAREVDGLRRRAVARRAETADMLRR
ERGINTSLVRRADRKAFDKWASLSHGVSFRQGLNMPRDTLFASNFTNTLVPETIIGPYFVLGERIRKNLVDGQPG
VPTRLDMQFIDVHTCKPIPRLVIDVWHANATGVYSAVSAPGQGGLETNHGRGVQMTDDDGVVQFDTVFPGHYAGR
ANHFHVMSTDGDGRTARHIGQTYMDDNLVQAVRKVQPYSSNRQPWTPNAMDAFAADEATPEYDPFMRHVFLGESP
ADGLLLWITIGIDPQADYSRRRFAASWYRPNGSIDLTARPKEPQQRVRFTKSEPKPEPKPEPKPEQKKPQPEQKP
KHEPPEPAGPKPAEQPKPEAKKRT*
Coding >Ophcf2|04952
ATGGCTCGTTTCAGCTGCGCTCTTGCGCTCGCCCTCTTCTTCGCCCTCTTGGTTGATGCGCATCCCAAGACGGGC
GAGGAGATGGAGAGGGCGTTGAGGCTTCGGTCTGTTGTTACCGAGAGGTCGAGGACCGCGCTTGATCGGTGCTCT
GGGGCGCGAGAGGTGGATGGGTTGAGGAGGAGGGCTGTTGCTAGGAGGGCGGAGACGGCGGATATGCTTCGACGG
GAGAGGGGCATCAACACTTCCCTCGTCCGGAGAGCCGATAGAAAGGCCTTTGACAAATGGGCCTCCCTCTCTCAC
GGCGTCTCGTTCCGTCAGGGACTCAACATGCCCAGGGACACGCTCTTCGCCTCAAACTTCACCAACACGCTCGTA
CCGGAGACCATCATCGGGCCATACTTTGTCCTAGGCGAACGCATCCGTAAGAACCTCGTCGACGGCCAGCCCGGG
GTCCCGACAAGGCTGGACATGCAGTTCATCGACGTTCACACCTGCAAGCCTATCCCTCGCCTCGTCATCGACGTC
TGGCACGCCAACGCCACGGGTGTCTATTCCGCCGTCTCTGCTCCCGGTCAGGGTGGGCTGGAGACGAATCACGGG
AGGGGCGTGCAGATGACGGATGATGATGGCGTCGTGCAGTTCGATACCGTCTTTCCGGGCCATTATGCCGGACGC
GCCAACCATTTCCACGTCATGTCCACCGACGGCGATGGCAGGACGGCTCGTCACATCGGCCAGACGTACATGGAC
GACAACCTCGTCCAGGCCGTCAGGAAGGTCCAGCCTTATAGCAGCAATCGTCAGCCTTGGACGCCCAATGCCATG
GACGCCTTTGCCGCCGACGAGGCAACGCCCGAGTACGACCCCTTTATGAGGCACGTCTTTCTCGGTGAGTCGCCG
GCCGACGGCCTGTTGCTGTGGATCACCATCGGCATCGATCCTCAGGCGGACTATTCGCGTCGCCGCTTTGCCGCC
TCCTGGTATCGTCCCAACGGAAGCATCGACTTGACCGCTCGACCGAAGGAGCCCCAGCAGAGGGTCAGGTTCACC
AAGTCGGAGCCCAAGCCGGAGCCCAAGCCGGAGCCCAAGCCGGAGCAGAAGAAGCCCCAGCCCGAGCAAAAGCCC
AAACATGAACCGCCCGAGCCGGCAGGACCTAAACCCGCAGAGCAGCCCAAGCCCGAAGCCAAGAAGCGCACCTAG
Transcript >Ophcf2|04952
ATGGCTCGTTTCAGCTGCGCTCTTGCGCTCGCCCTCTTCTTCGCCCTCTTGGTTGATGCGCATCCCAAGACGGGC
GAGGAGATGGAGAGGGCGTTGAGGCTTCGGTCTGTTGTTACCGAGAGGTCGAGGACCGCGCTTGATCGGTGCTCT
GGGGCGCGAGAGGTGGATGGGTTGAGGAGGAGGGCTGTTGCTAGGAGGGCGGAGACGGCGGATATGCTTCGACGG
GAGAGGGGCATCAACACTTCCCTCGTCCGGAGAGCCGATAGAAAGGCCTTTGACAAATGGGCCTCCCTCTCTCAC
GGCGTCTCGTTCCGTCAGGGACTCAACATGCCCAGGGACACGCTCTTCGCCTCAAACTTCACCAACACGCTCGTA
CCGGAGACCATCATCGGGCCATACTTTGTCCTAGGCGAACGCATCCGTAAGAACCTCGTCGACGGCCAGCCCGGG
GTCCCGACAAGGCTGGACATGCAGTTCATCGACGTTCACACCTGCAAGCCTATCCCTCGCCTCGTCATCGACGTC
TGGCACGCCAACGCCACGGGTGTCTATTCCGCCGTCTCTGCTCCCGGTCAGGGTGGGCTGGAGACGAATCACGGG
AGGGGCGTGCAGATGACGGATGATGATGGCGTCGTGCAGTTCGATACCGTCTTTCCGGGCCATTATGCCGGACGC
GCCAACCATTTCCACGTCATGTCCACCGACGGCGATGGCAGGACGGCTCGTCACATCGGCCAGACGTACATGGAC
GACAACCTCGTCCAGGCCGTCAGGAAGGTCCAGCCTTATAGCAGCAATCGTCAGCCTTGGACGCCCAATGCCATG
GACGCCTTTGCCGCCGACGAGGCAACGCCCGAGTACGACCCCTTTATGAGGCACGTCTTTCTCGGTGAGTCGCCG
GCCGACGGCCTGTTGCTGTGGATCACCATCGGCATCGATCCTCAGGCGGACTATTCGCGTCGCCGCTTTGCCGCC
TCCTGGTATCGTCCCAACGGAAGCATCGACTTGACCGCTCGACCGAAGGAGCCCCAGCAGAGGGTCAGGTTCACC
AAGTCGGAGCCCAAGCCGGAGCCCAAGCCGGAGCCCAAGCCGGAGCAGAAGAAGCCCCAGCCCGAGCAAAAGCCC
AAACATGAACCGCCCGAGCCGGCAGGACCTAAACCCGCAGAGCAGCCCAAGCCCGAAGCCAAGAAGCGCACCTAG
Gene >Ophcf2|04952
ATGGCTCGTTTCAGCTGCGCTCTTGCGCTCGCCCTCTTCTTCGCCCTCTTGGTTGATGCGCATCCCAAGACGGGC
GAGGAGATGGAGAGGGCGTTGAGGCTTCGGTCTGTTGTTACCGAGAGGTCGAGGACCGCGCTTGATCGGTGCTCT
GGGGCGCGAGAGGTGGATGGGTTGAGGAGGAGGGCTGTTGCTAGGAGGGCGGAGACGGCGGATATGCTTCGACGG
GAGAGGGGCATCAACACTTGTAAGTGAAGGAGCCTCCCTTTTTTTGGTTTTTCATCGTGAGTCGACATCATGCTC
AACTCTTGTCCGTTAGCCCTCGTCCGGAGAGCCGATAGAAAGGCCTTTGACAAATGGGCCTCCCTCTCTCACGGC
GTCTCGTTCCGTCAGGGACTCAACATGCCCAGGGACACGCTCTTCGCCTCAAACTTCACCAACACGCTCGTACCG
GAGACCATCATCGGGCCATACTTTGTCCTAGGCGAACGCATCCGTAAGAACCTCGTCGACGGCCAGCCCGGGGTC
CCGACAAGGCTGGACATGCAGTTCATCGACGTTCACACCTGCAAGCCTATCCCTCGCCTCGTCATCGACGTCTGG
CACGCCAACGCCACGGGTGTCTATTCCGCCGTCTCTGCTCCCGGTCAGGGTGGGCTGGAGACGAATCACGGGAGG
GGCGTGCAGATGACGGATGATGATGGCGTCGTGCAGTTCGATACCGTCTTTCCGGGCCATTATGCCGGACGCGCC
AACCATTTCCACGTCATGTCCACCGACGGCGATGGCAGGACGGCTCGTCACATCGGCCAGACGTACATGGACGAC
AACCTCGTCCAGGCCGTCAGGAAGGTCCAGCCTTATAGCAGCAATCGTCAGCCTTGGACGCCCAATGCCATGGAC
GCCTTTGCCGCCGACGAGGCAACGCCCGAGTACGACCCCTTTATGAGGCACGTCTTTCTCGGTGAGTCGCCGGCC
GACGGCCTGTTGCTGTGGATCACCATCGGCATCGATCCTCAGGCGGACTATTCGCGTCGCCGCTTTGCCGCCTCC
TGGTATCGTCCCAACGGAAGCATCGACTTGACCGCTCGACCGAAGGAGCCCCAGCAGAGGGTCAGGTTCACCAAG
TCGGAGCCCAAGCCGGAGCCCAAGCCGGAGCCCAAGCCGGAGCAGAAGAAGCCCCAGCCCGAGCAAAAGCCCAAA
CATGAACCGCCCGAGCCGGCAGGACCTAAACCCGCAGAGCAGCCCAAGCCCGAAGCCAAGAAGCGCACCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail