Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04950
Gene name
Locationscaffold_05:2058647..2059264
Strand-
Gene length (bp)617
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 13.64 2.95 24.33
Alive In ants, during behavior modification 3962.57 1547.99 6377.14
Dead In ants, recently dead 1177.48 581.39 1773.58

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04950
MSSNTTGTSTPIAIAVALSTTATIALVLTLLERKLLVLAPEKAKDNEARSSDAKNVTVSAQTSPRLLHRPFTPTA
AGIAMSSPGPPPDRALPPTPLRADHVVEAAGRSVPSPSPSPAPAPAPAPAPTPTRPEPVRRGIFSDYLQQEGALE
RLVGPCR*
Coding >Ophcf2|04950
ATGTCGTCCAACACCACCGGAACGTCCACCCCCATCGCCATAGCCGTCGCCCTGTCCACCACGGCGACGATAGCC
CTGGTCTTGACATTGCTGGAAAGGAAGCTCCTCGTTCTCGCGCCGGAAAAGGCCAAGGATAATGAAGCTCGCTCT
TCCGACGCGAAAAACGTCACCGTCTCGGCCCAGACTTCTCCCCGTCTCCTTCATCGGCCCTTTACACCCACCGCC
GCGGGAATAGCCATGTCTTCTCCCGGCCCTCCTCCCGATCGCGCTCTCCCTCCGACGCCTCTGCGCGCAGACCAC
GTCGTTGAAGCCGCGGGCCGCTCAGTCCCGTCTCCGTCTCCGTCTCCGGCCCCGGCTCCGGCTCCGGCCCCGGCT
CCTACCCCTACCCGTCCCGAGCCTGTCCGACGGGGCATCTTCAGTGACTACCTGCAGCAAGAGGGTGCGCTGGAA
CGACTGGTCGGCCCCTGCAGGTGA
Transcript >Ophcf2|04950
ATGTCGTCCAACACCACCGGAACGTCCACCCCCATCGCCATAGCCGTCGCCCTGTCCACCACGGCGACGATAGCC
CTGGTCTTGACATTGCTGGAAAGGAAGCTCCTCGTTCTCGCGCCGGAAAAGGCCAAGGATAATGAAGCTCGCTCT
TCCGACGCGAAAAACGTCACCGTCTCGGCCCAGACTTCTCCCCGTCTCCTTCATCGGCCCTTTACACCCACCGCC
GCGGGAATAGCCATGTCTTCTCCCGGCCCTCCTCCCGATCGCGCTCTCCCTCCGACGCCTCTGCGCGCAGACCAC
GTCGTTGAAGCCGCGGGCCGCTCAGTCCCGTCTCCGTCTCCGTCTCCGGCCCCGGCTCCGGCTCCGGCCCCGGCT
CCTACCCCTACCCGTCCCGAGCCTGTCCGACGGGGCATCTTCAGTGACTACCTGCAGCAAGAGGGTGCGCTGGAA
CGACTGGTCGGCCCCTGCAGGTGA
Gene >Ophcf2|04950
ATGTCGTCCAACACCACCGGAACGTCCACCCCCATCGCCATAGCCGTCGCCCTGTCCACCACGGCGACGATAGCC
CTGGTCTTGACATTGCTGGTATGGCACCTCCGTCGGAAACGCACCAAGCTAGACGACGACGACGACGACGACGAC
GACTTGGAATCCCCCACGCCCCTCGTCCCCCCAGGGCTTCCCTCCCAAACAACAGCACTCCATTGACACCCCCCC
CGCGCCTCCAGGAAAGGAAGCTCCTCGTTCTCGCGCCGGAAAAGGCCAAGGATAATGAAGCTCGCTCTTCCGACG
CGAAAAACGTCACCGTCTCGGCCCAGACTTCTCCCCGTCTCCTTCATCGGCCCTTTACACCCACCGCCGCGGGAA
TAGCCATGTCTTCTCCCGGCCCTCCTCCCGATCGCGCTCTCCCTCCGACGCCTCTGCGCGCAGACCACGTCGTTG
AAGCCGCGGGCCGCTCAGTCCCGTCTCCGTCTCCGTCTCCGGCCCCGGCTCCGGCTCCGGCCCCGGCTCCTACCC
CTACCCGTCCCGAGCCTGTCCGACGGGGCATCTTCAGTGACTACCTGCAGCAAGAGGGTGCGCTGGAACGACTGG
TCGGCCCCTGCAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail