Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04950
Gene name
Locationscaffold_05:2058647..2059264
Strand-
Gene length (bp)617
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.2126 0.1922 0.3286 0.4171 0.3816 0.1307 0.3779 0.4412 0.3869 0.1268

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 12 31 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup7389
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|04950 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5666
Ophiocordyceps kimflemingae Ophio5|1603

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04950
MSSNTTGTSTPIAIAVALSTTATIALVLTLLERKLLVLAPEKAKDNEARSSDAKNVTVSAQTSPRLLHRPFTPTA
AGIAMSSPGPPPDRALPPTPLRADHVVEAAGRSVPSPSPSPAPAPAPAPAPTPTRPEPVRRGIFSDYLQQEGALE
RLVGPCR*
Coding >Ophcf2|04950
ATGTCGTCCAACACCACCGGAACGTCCACCCCCATCGCCATAGCCGTCGCCCTGTCCACCACGGCGACGATAGCC
CTGGTCTTGACATTGCTGGAAAGGAAGCTCCTCGTTCTCGCGCCGGAAAAGGCCAAGGATAATGAAGCTCGCTCT
TCCGACGCGAAAAACGTCACCGTCTCGGCCCAGACTTCTCCCCGTCTCCTTCATCGGCCCTTTACACCCACCGCC
GCGGGAATAGCCATGTCTTCTCCCGGCCCTCCTCCCGATCGCGCTCTCCCTCCGACGCCTCTGCGCGCAGACCAC
GTCGTTGAAGCCGCGGGCCGCTCAGTCCCGTCTCCGTCTCCGTCTCCGGCCCCGGCTCCGGCTCCGGCCCCGGCT
CCTACCCCTACCCGTCCCGAGCCTGTCCGACGGGGCATCTTCAGTGACTACCTGCAGCAAGAGGGTGCGCTGGAA
CGACTGGTCGGCCCCTGCAGGTGA
Transcript >Ophcf2|04950
ATGTCGTCCAACACCACCGGAACGTCCACCCCCATCGCCATAGCCGTCGCCCTGTCCACCACGGCGACGATAGCC
CTGGTCTTGACATTGCTGGAAAGGAAGCTCCTCGTTCTCGCGCCGGAAAAGGCCAAGGATAATGAAGCTCGCTCT
TCCGACGCGAAAAACGTCACCGTCTCGGCCCAGACTTCTCCCCGTCTCCTTCATCGGCCCTTTACACCCACCGCC
GCGGGAATAGCCATGTCTTCTCCCGGCCCTCCTCCCGATCGCGCTCTCCCTCCGACGCCTCTGCGCGCAGACCAC
GTCGTTGAAGCCGCGGGCCGCTCAGTCCCGTCTCCGTCTCCGTCTCCGGCCCCGGCTCCGGCTCCGGCCCCGGCT
CCTACCCCTACCCGTCCCGAGCCTGTCCGACGGGGCATCTTCAGTGACTACCTGCAGCAAGAGGGTGCGCTGGAA
CGACTGGTCGGCCCCTGCAGGTGA
Gene >Ophcf2|04950
ATGTCGTCCAACACCACCGGAACGTCCACCCCCATCGCCATAGCCGTCGCCCTGTCCACCACGGCGACGATAGCC
CTGGTCTTGACATTGCTGGTATGGCACCTCCGTCGGAAACGCACCAAGCTAGACGACGACGACGACGACGACGAC
GACTTGGAATCCCCCACGCCCCTCGTCCCCCCAGGGCTTCCCTCCCAAACAACAGCACTCCATTGACACCCCCCC
CGCGCCTCCAGGAAAGGAAGCTCCTCGTTCTCGCGCCGGAAAAGGCCAAGGATAATGAAGCTCGCTCTTCCGACG
CGAAAAACGTCACCGTCTCGGCCCAGACTTCTCCCCGTCTCCTTCATCGGCCCTTTACACCCACCGCCGCGGGAA
TAGCCATGTCTTCTCCCGGCCCTCCTCCCGATCGCGCTCTCCCTCCGACGCCTCTGCGCGCAGACCACGTCGTTG
AAGCCGCGGGCCGCTCAGTCCCGTCTCCGTCTCCGTCTCCGGCCCCGGCTCCGGCTCCGGCCCCGGCTCCTACCC
CTACCCGTCCCGAGCCTGTCCGACGGGGCATCTTCAGTGACTACCTGCAGCAAGAGGGTGCGCTGGAACGACTGG
TCGGCCCCTGCAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail