Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04949
Gene name
Locationscaffold_05:2055720..2058220
Strand+
Gene length (bp)2500
Transcript length (bp)2382
Coding sequence length (bp)2382
Protein length (aa) 794

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01434 Peptidase_M41 Peptidase family M41 2.5E-52 560 739
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.8E-41 349 478
PF17862 AAA_lid_3 AAA+ lid domain 4.0E-09 501 543
PF07728 AAA_5 AAA domain (dynein-related subfamily) 8.0E-05 348 415

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0004176 ATP-dependent peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0008237 metallopeptidase activity No
GO:0008233 peptidase activity No
GO:0017076 purine nucleotide binding No
GO:0004175 endopeptidase activity No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 264 286 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 197.08 93.58 300.57
Alive In ants, during behavior modification 178.54 87.18 269.89
Dead In ants, recently dead 215.60 102.51 328.69

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.709014 no
Alive Dead 0.363957 no
Dead Fungus 0.749701 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04949
MAYQGAVLPTKAIHAWSTATNSLAASCLRLAGSAQPRRTFESRVEQMLKPCSPGNLGRAISLARPHKISRPITSS
PYCGGLGLRNLTGRALPLPSNGLASLMRRSISTYGSGAWRRSFGTANGISRNQLASLEESANRNPGNANAQNSFY
QLLLRANMPGILVERHQSGRFATNAATEESYKKALAALNAGTNLTAGASPSPSPASSFVNRQWTGSEQQPQAYAP
VSPFGSTNPFQAQMGARGLPLHVVIQETMAGYLFKLVKAIAYYLVYLYLAYVAVTLAIEWMSSSRRPGGISMSDT
SQVEAQKQSTRLSDVHGCDEAKEELQEVIEFLRNPEKFTDLGAKLPKGVLLVGPPGTGKTLLARAVAGEAGVPFF
YMSGSAFDEIYVGVGAKRVRDLFHAAKSKAPAIVFIDELDAIGGKRNPRDHAHAKQTLNQLLTELDGFDQDTKIV
IMAATNLPSLLDKALTRPGRFDRHIDVGLPDFRGRLAILEHHAKKIKLDENVDLGSVAARCPGYSGAELENMLNI
AALRASRARANTISMRDVDWAYDRILMGSERKSIVISAKDKETTAYHEAGHAIVRLFESDSKANLYKVTILPKGQ
SLGHTSFVQEADKYSQSMAECMADIRVLLGGKMAEEMHSGTDKVTTGVSNDLEKATDLSYMMVTSFGMSDALGPV
EYGRRYENLSSETRAKIEAEVQRTLNTSYEAVRKILTERRKELDLLAKALIQYETLSKAEVERVIRGEELTERTA
VPPGPLILPIPEQTPEPPGLSGVTQSDPPESPAPPAAAESSSS*
Coding >Ophcf2|04949
ATGGCTTACCAAGGAGCGGTGTTGCCGACCAAGGCCATCCACGCCTGGTCGACGGCGACAAACTCGCTCGCCGCA
TCGTGTCTTCGACTCGCGGGCTCTGCGCAACCGCGCCGTACCTTTGAAAGTCGTGTCGAGCAGATGCTGAAACCT
TGTTCGCCTGGTAATTTGGGACGCGCCATATCCCTCGCTCGACCTCATAAAATTTCGAGACCCATCACGTCGAGC
CCGTACTGCGGCGGCTTGGGTTTGCGAAATTTGACGGGACGGGCACTGCCCCTACCCTCCAATGGTCTCGCGTCG
CTGATGCGCCGGTCCATTTCGACCTACGGCTCCGGTGCTTGGCGTAGGAGTTTCGGCACCGCCAACGGAATCTCG
CGCAATCAACTGGCTTCTCTCGAAGAATCGGCCAACCGCAACCCGGGCAATGCGAATGCGCAAAACTCGTTCTAC
CAGCTCTTGCTGAGAGCCAACATGCCTGGCATCTTGGTCGAGCGGCATCAGTCGGGTCGATTCGCCACGAACGCT
GCAACTGAGGAATCTTACAAGAAGGCTCTCGCCGCCTTGAACGCGGGGACCAACCTGACGGCCGGCGCGTCACCG
TCGCCATCACCGGCGTCATCGTTTGTCAACCGTCAATGGACAGGCAGCGAACAGCAACCGCAGGCCTACGCCCCG
GTCTCTCCCTTCGGCAGCACGAATCCTTTCCAAGCTCAGATGGGGGCTAGGGGACTGCCGCTGCACGTCGTCATC
CAGGAGACGATGGCGGGATATCTATTCAAGCTGGTAAAGGCCATTGCTTACTATCTCGTCTACCTCTACTTGGCG
TATGTTGCCGTCACACTGGCCATAGAGTGGATGTCTTCTTCTAGAAGACCCGGAGGCATCAGCATGAGCGATACC
TCCCAGGTCGAGGCCCAGAAGCAGTCGACCCGGCTGAGCGACGTCCACGGCTGCGACGAAGCCAAGGAGGAGCTG
CAGGAAGTCATCGAGTTCCTGCGAAACCCTGAAAAGTTCACGGATCTCGGTGCCAAGCTCCCCAAGGGCGTCCTT
CTCGTCGGTCCTCCAGGGACCGGCAAGACGCTACTGGCCAGGGCCGTGGCTGGGGAAGCCGGCGTCCCCTTCTTC
TACATGTCCGGCAGCGCATTCGACGAGATATACGTCGGCGTCGGCGCCAAACGAGTCCGGGATCTCTTCCACGCG
GCCAAGTCCAAGGCGCCGGCCATCGTCTTCATCGACGAGCTCGACGCCATCGGAGGCAAGCGAAATCCCCGGGAT
CATGCGCACGCCAAACAGACGCTCAACCAACTCCTGACTGAGCTCGACGGCTTTGACCAGGATACCAAGATTGTC
ATCATGGCAGCCACCAACCTGCCCAGCCTCCTCGACAAGGCCCTGACGCGGCCGGGCCGCTTCGATCGGCACATC
GACGTCGGCCTGCCAGATTTTCGCGGCCGTCTCGCCATACTAGAACATCACGCCAAGAAGATCAAGCTGGACGAA
AACGTCGACCTTGGGTCCGTCGCGGCCCGCTGCCCCGGATACTCGGGCGCCGAGCTCGAGAACATGCTCAACATT
GCGGCGCTGAGGGCGTCGCGGGCCAGGGCAAACACAATCTCCATGCGGGACGTCGACTGGGCCTACGACAGGATC
CTCATGGGCTCCGAGAGGAAGTCGATAGTCATCTCGGCCAAGGACAAGGAGACGACGGCATACCACGAGGCGGGT
CACGCCATTGTCCGACTGTTTGAGAGCGACAGCAAGGCCAATCTGTACAAGGTGACGATCCTGCCCAAGGGCCAG
TCGCTGGGCCACACGTCCTTTGTTCAGGAGGCGGACAAGTACTCTCAGTCGATGGCCGAGTGCATGGCGGACATA
CGGGTTCTTCTCGGGGGCAAGATGGCGGAAGAGATGCACTCGGGGACCGACAAGGTGACGACGGGCGTGTCCAAT
GACCTCGAGAAGGCCACGGACCTCAGCTACATGATGGTGACGAGTTTCGGCATGTCGGACGCCCTCGGGCCCGTA
GAATACGGCCGACGGTACGAGAACCTCAGCTCGGAGACGCGGGCCAAGATCGAGGCCGAGGTTCAGCGGACGCTC
AACACGTCGTACGAGGCTGTGAGGAAGATTTTGACGGAGCGGCGCAAGGAGCTGGACCTGCTGGCCAAGGCGCTC
ATCCAGTACGAGACGCTCAGCAAGGCCGAGGTCGAGAGGGTCATTCGCGGCGAGGAGCTGACGGAGAGGACGGCG
GTCCCGCCGGGACCCCTGATCCTGCCGATACCGGAGCAGACGCCGGAGCCTCCGGGGCTGAGCGGCGTGACGCAG
TCGGATCCTCCCGAGTCGCCGGCGCCACCGGCCGCGGCCGAGTCTTCCAGCAGCTGA
Transcript >Ophcf2|04949
ATGGCTTACCAAGGAGCGGTGTTGCCGACCAAGGCCATCCACGCCTGGTCGACGGCGACAAACTCGCTCGCCGCA
TCGTGTCTTCGACTCGCGGGCTCTGCGCAACCGCGCCGTACCTTTGAAAGTCGTGTCGAGCAGATGCTGAAACCT
TGTTCGCCTGGTAATTTGGGACGCGCCATATCCCTCGCTCGACCTCATAAAATTTCGAGACCCATCACGTCGAGC
CCGTACTGCGGCGGCTTGGGTTTGCGAAATTTGACGGGACGGGCACTGCCCCTACCCTCCAATGGTCTCGCGTCG
CTGATGCGCCGGTCCATTTCGACCTACGGCTCCGGTGCTTGGCGTAGGAGTTTCGGCACCGCCAACGGAATCTCG
CGCAATCAACTGGCTTCTCTCGAAGAATCGGCCAACCGCAACCCGGGCAATGCGAATGCGCAAAACTCGTTCTAC
CAGCTCTTGCTGAGAGCCAACATGCCTGGCATCTTGGTCGAGCGGCATCAGTCGGGTCGATTCGCCACGAACGCT
GCAACTGAGGAATCTTACAAGAAGGCTCTCGCCGCCTTGAACGCGGGGACCAACCTGACGGCCGGCGCGTCACCG
TCGCCATCACCGGCGTCATCGTTTGTCAACCGTCAATGGACAGGCAGCGAACAGCAACCGCAGGCCTACGCCCCG
GTCTCTCCCTTCGGCAGCACGAATCCTTTCCAAGCTCAGATGGGGGCTAGGGGACTGCCGCTGCACGTCGTCATC
CAGGAGACGATGGCGGGATATCTATTCAAGCTGGTAAAGGCCATTGCTTACTATCTCGTCTACCTCTACTTGGCG
TATGTTGCCGTCACACTGGCCATAGAGTGGATGTCTTCTTCTAGAAGACCCGGAGGCATCAGCATGAGCGATACC
TCCCAGGTCGAGGCCCAGAAGCAGTCGACCCGGCTGAGCGACGTCCACGGCTGCGACGAAGCCAAGGAGGAGCTG
CAGGAAGTCATCGAGTTCCTGCGAAACCCTGAAAAGTTCACGGATCTCGGTGCCAAGCTCCCCAAGGGCGTCCTT
CTCGTCGGTCCTCCAGGGACCGGCAAGACGCTACTGGCCAGGGCCGTGGCTGGGGAAGCCGGCGTCCCCTTCTTC
TACATGTCCGGCAGCGCATTCGACGAGATATACGTCGGCGTCGGCGCCAAACGAGTCCGGGATCTCTTCCACGCG
GCCAAGTCCAAGGCGCCGGCCATCGTCTTCATCGACGAGCTCGACGCCATCGGAGGCAAGCGAAATCCCCGGGAT
CATGCGCACGCCAAACAGACGCTCAACCAACTCCTGACTGAGCTCGACGGCTTTGACCAGGATACCAAGATTGTC
ATCATGGCAGCCACCAACCTGCCCAGCCTCCTCGACAAGGCCCTGACGCGGCCGGGCCGCTTCGATCGGCACATC
GACGTCGGCCTGCCAGATTTTCGCGGCCGTCTCGCCATACTAGAACATCACGCCAAGAAGATCAAGCTGGACGAA
AACGTCGACCTTGGGTCCGTCGCGGCCCGCTGCCCCGGATACTCGGGCGCCGAGCTCGAGAACATGCTCAACATT
GCGGCGCTGAGGGCGTCGCGGGCCAGGGCAAACACAATCTCCATGCGGGACGTCGACTGGGCCTACGACAGGATC
CTCATGGGCTCCGAGAGGAAGTCGATAGTCATCTCGGCCAAGGACAAGGAGACGACGGCATACCACGAGGCGGGT
CACGCCATTGTCCGACTGTTTGAGAGCGACAGCAAGGCCAATCTGTACAAGGTGACGATCCTGCCCAAGGGCCAG
TCGCTGGGCCACACGTCCTTTGTTCAGGAGGCGGACAAGTACTCTCAGTCGATGGCCGAGTGCATGGCGGACATA
CGGGTTCTTCTCGGGGGCAAGATGGCGGAAGAGATGCACTCGGGGACCGACAAGGTGACGACGGGCGTGTCCAAT
GACCTCGAGAAGGCCACGGACCTCAGCTACATGATGGTGACGAGTTTCGGCATGTCGGACGCCCTCGGGCCCGTA
GAATACGGCCGACGGTACGAGAACCTCAGCTCGGAGACGCGGGCCAAGATCGAGGCCGAGGTTCAGCGGACGCTC
AACACGTCGTACGAGGCTGTGAGGAAGATTTTGACGGAGCGGCGCAAGGAGCTGGACCTGCTGGCCAAGGCGCTC
ATCCAGTACGAGACGCTCAGCAAGGCCGAGGTCGAGAGGGTCATTCGCGGCGAGGAGCTGACGGAGAGGACGGCG
GTCCCGCCGGGACCCCTGATCCTGCCGATACCGGAGCAGACGCCGGAGCCTCCGGGGCTGAGCGGCGTGACGCAG
TCGGATCCTCCCGAGTCGCCGGCGCCACCGGCCGCGGCCGAGTCTTCCAGCAGCTGA
Gene >Ophcf2|04949
ATGGCTTACCAAGGAGCGGTGTTGCCGGTGAGTCGAACTTGACCCCCTTGCCTCCCACGGTCGCTAACTTGGTTC
GTTGAGACCAAGGCCATCCACGCCTGGTCGACGGCGACAAACTCGCTCGCCGCATCGTGTCTTCGACTCGCGGGC
TCTGCGCAACCGCGCCGTACCTTTGAAAGTCGTGTCGAGCAGATGCTGAAACCTTGTTCGCCTGGTAATTTGGGA
CGCGCCATATCCCTCGCTCGACCTCATAAAATTTCGAGACCCATCACGTCGAGCCCGTACTGCGGCGGCTTGGGT
TTGCGAAATTTGACGGGACGGGCACTGCCCCTACCCTCCAATGGTCTCGCGTCGCTGATGCGCCGGTCCATTTCG
ACCTACGGCTCCGGTGCTTGGCGTAGGAGTTTCGGCACCGCCAACGGAATCTCGCGCAATCAACTGGCTTCTCTC
GAAGAATCGGCCAACCGCAACCCGGGCAATGCGAATGCGCAAAACTCGTTCTACCAGCTCTTGCTGAGAGCCAAC
ATGCCTGGCATCTTGGTCGAGCGGCATCAGTCGGGTCGATTCGCCACGAACGCTGCAACTGAGGAATCTTACAAG
AAGGCTCTCGCCGCCTTGAACGCGGGGACCAACCTGACGGCCGGCGCGTCACCGTCGCCATCACCGGCGTCATCG
TTTGTCAACCGTCAATGGACAGGCAGCGAACAGCAACCGCAGGCCTACGCCCCGGTCTCTCCCTTCGGCAGCACG
AATCCTTTCCAAGCTCAGATGGGGGCTAGGGGACTGCCGCTGCACGTCGTCATCCAGGAGACGATGGCGGGATAT
CTATTCAAGCTGGTAAAGGCCATTGCTTACTATCTCGTCTACCTCTACTTGGCGTATGTTGCCGTCACACTGGCC
ATAGAGTGGATGTCTTCTTCTAGAAGACCCGGAGGCATCAGCATGAGCGATACCTCCCAGGTCGAGGCCCAGAAG
CAGTCGACCCGGCTGAGCGACGTCCACGGCTGCGACGAAGCCAAGGAGGAGCTGCAGGAAGTCATCGAGTTCCTG
CGAAACCCTGAAAAGTTCACGGATCTCGGTGCCAAGCTCCCCAAGGGCGTCCTTCTCGTCGGTCCTCCAGGGACC
GGCAAGACGCTACTGGCCAGGGCCGTGGCTGGGGAAGCCGGCGTCCCCTTCTTCTACATGTCCGGCAGCGCATTC
GACGAGATATACGTCGGCGTCGGCGCCAAACGAGTCCGGGATCTCTTCCACGCGGCCAAGTCCAAGGCGCCGGCC
ATCGTCTTCATCGACGAGCTCGACGCCATCGGAGGCAAGCGAAATCCCCGGGATCATGCGCACGCCAAACAGACG
CTCAACCAACTCCTGACTGAGCTCGACGGCTTTGACCAGGATACCAAGATTGTCATCATGGCAGCCACCAACCTG
CCCAGCCTCCTCGACAAGGCCCTGACGCGGCCGGGCCGCTTCGATCGGCACATCGACGTCGGCCTGCCAGATTTT
CGCGGCCGTCTCGCCATACTAGAACATCACGCCAAGAAGATCAAGCTGGACGAAAACGTCGACCTTGGGTCCGTC
GCGGCCCGCTGCCCCGGATACTCGGGCGCCGAGCTCGAGAACATGCTCAACATTGCGGCGCTGAGGGCGTCGCGG
GCCAGGGCAAACACAATCTCCATGCGGGACGTCGACTGGGCCTACGACAGGATCCTCATGGGCTCCGAGAGGAAG
TCGATAGTCATCTCGGCCAAGGACAAGGAGACGACGGCATACCACGAGGCGGGTCACGCCATTGTCCGACTGTTT
GAGAGCGACAGCAAGGCCAATCTGTACAAGGTGACGATCCTGCCCAAGGGCCAGTCGCTGGGCCACACGTCCTTT
GTTCAGGAGGCGGACAAGTACTCTCAGTCGATGGCCGAGTGCATGGCGGACATACGGGTTCTTCTCGGGGGCAAG
ATGGCGGAAGAGATGCACTCGGGGACCGACAAGGTGACGACGGGCGTGTCCAATGTGAGTTGAAGCTGGGGCAAA
ATGGAAATTGTACCGATACCGACCTCTTACTCACTCTAAACAGGACCTCGAGAAGGCCACGGACCTCAGCTACAT
GATGGTGACGAGTTTCGGCATGTCGGACGCCCTCGGGCCCGTAGAATACGGCCGACGGTACGAGAACCTCAGCTC
GGAGACGCGGGCCAAGATCGAGGCCGAGGTTCAGCGGACGCTCAACACGTCGTACGAGGCTGTGAGGAAGATTTT
GACGGAGCGGCGCAAGGAGCTGGACCTGCTGGCCAAGGCGCTCATCCAGTACGAGACGCTCAGCAAGGCCGAGGT
CGAGAGGGTCATTCGCGGCGAGGAGCTGACGGAGAGGACGGCGGTCCCGCCGGGACCCCTGATCCTGCCGATACC
GGAGCAGACGCCGGAGCCTCCGGGGCTGAGCGGCGTGACGCAGTCGGATCCTCCCGAGTCGCCGGCGCCACCGGC
CGCGGCCGAGTCTTCCAGCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail