Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04947
Gene name
Locationscaffold_05:2034501..2042427
Strand+
Gene length (bp)7926
Transcript length (bp)6768
Coding sequence length (bp)6768
Protein length (aa) 2256

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family 4.6E-70 1898 2223
PF13637 Ank_4 Ankyrin repeats (many copies) 8.6E-06 1559 1604
PF13637 Ank_4 Ankyrin repeats (many copies) 3.7E-08 1626 1677
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.0E-14 1558 1654
PF03105 SPX SPX domain 5.8E-09 1095 1130

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008081 phosphoric diester hydrolase activity Yes
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5671 0.3932 0.0442 0.1241 0.1672 0.0194 0.178 0.0686 0.1359 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup564
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3857
Ophiocordyceps australis map64 (Brazil) OphauB2|305
Ophiocordyceps camponoti-floridani Ophcf2|04947 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3532
Ophiocordyceps kimflemingae Ophio5|8356
Ophiocordyceps subramaniannii Hirsu2|498
Ophiocordyceps subramaniannii Hirsu2|5955
Ophiocordyceps subramaniannii Hirsu2|932

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04947
MSAAIADVSRKGRRLAELDQQLDAARQALVALQSADTTSKEPEAPSLDAAMPEISLDQMKHLWVSLKEVWFARPY
MKELHMPATASTSKLVLSLKERLYGSPTEESMRDTRKTDYKRYHREALAEESDPSIIVREAQKDSHLHHESRAVE
HVVLQLLSRAAKIHTCARRGQNPSFDEARDLVSRSAMQYTYPIIDRERWRRNQLLLNKCLREVIDLRNIPLREKI
GRICYNLLVSAYAPDIHHYNTLIVAFDEAGLHAFAEAIIWSFFHGRLLRPTALTYIAILNHCKVVGNHGRFLMAL
ARIAGCDSAIGGKIARRHIEDCVRDGQLNEWASDTDLRTQIGEWVYEHVPLNRAIVAEIITGLLRFHMFHHAVHF
FFACVQCEVFLSAAVVKNLLDECVAALDWKGAFELIYGLLVHDRSWKAFLLTGDVAADWYLINRIYTLLDICGLR
YGPQWTSREYLDALGIPPERLAGLLFDLELHEQWLHRPCFPESFKGKPDMAVGAKSKLLQLESISKEYVYVRKTT
KSIESKLLYPDFPLEWRVSMAHHIGGAALQQASQLIKDVEDMLRSIVGFGPWLYPIDSDRRMEARKRYLRRAREE
ASDEAETGLEGEATGSSRTEALPAQGNLVPIHTCPREAAERKQRQALVSQLRALRHEVDQPRVETVSLQSPERSA
LEEEMISQIRALRRGGEEPTLKAPTSPQEAHQDSASLVEESESLAQPAGTKRESTEQPPQGTSLALALREQHGVM
VPLPEGSRFLDIIRSRYRRSDTSDEGVLRHVQKRRDPAAPNVRRTEATQKSRCDRSNRDRSNLGRIMQDARISDA
RTPLRSRENEVKRRRPVARWNEAAQPPSRDAHLARRERQETRRQTWKPGATMPVSQGGTEMNTKQLIALWSPTAY
ASSTMESREDLDAAAAGKNSRTTPKPRMRNKVRRGMQLLRKAGRELTMELPLEAFAPHLVEPTVEDDPHEAARVA
ADAKDYKDCAKVRIGKKSEKAKSSDGGRRPATADIAAETQGQDSPWSPMKRQAAKPSDRMAHVSEDSGDVWTTMG
SASKTKLSDRDKSGAQNARAELETPQTPVVFVVFVVFVVFVVAGMKFGRSLPRNQVPQWAAFYINYKGLKKLVKA
ASQRAQDGVAVDPAELFFALDRNLEDVDSFYNKKFAEACRRLNILHNRYGRVPDVVATLDQDEVEEVMAALLELR
TQLRNLQWFGEINRRGFVKITKKLDKKVPAMSSQHRYISTKVDPKPFAKDGSIARLLAEINRWLSVLGDADNVDD
STSDRSTRSLGRASAKAMLLLPQAQLDALDQAVRNDDVVALKSGVDEASLLGGLDAQGQSQGQGLLLNLLQRSIS
ARSRDCMAHLLACIKDLDEPDDINGRNCIHRFVIHIGRTKSAALPTNGGGDSAKPYPQFIQGHIQPAVSSTVPVK
TINTKEEDHLGEDDEAVQTLLFLLGQLTAQQRQALNRRDSLGRLPLHYAAQFGFVVVCQIIMGKMQEWNQFDVKD
GIDAPEWQDNDGYAPLHLSVIGGHPLTTQALLQGENWQGSSEAKEELRKSVPKSGAVLALAVKSNYEPIVEMLVK
AGVDINWTDKTGESVLHIAARHGHVGCARIILEGSGSQRAELETTEKAYSWTPLHVAAVDGSVAVARLLMEAGAD
VSRPDASGWTAKEHAALRGHMDMARMLAVHTNEDEAVSRVAARLQAPENSSIDERRSIGGPRPAEPVKSFGHRYL
TNESLVLVSLGSMDIRKSTDVVNLECVPLTEAHNTQLDTALSVVVSANGAQGEPTIIDLPVHEGISTEPVVFTTR
DATKVKLLFDMVPTYSGSEKNKIGRAVALLSSIKPTLGTQRVNLQGDVCVPIMSSNLDVMGTVNFNFLVITPFHH
VNMEVTSRQTYWKKLSSTMVIGHRGLGKNLTSNKSLQLGENTLPSFIAAANLGAQYVEFDVQLTKDHVPVIYHDF
LVSETGIDAPVHTLTLEQFLHINSDKRRADGGAPLPGGGSGRDVPRERSPRPRSNSLAPQRSLSMGYAGVGHEEM
EERMRHTRDFKEKGYKANSRGNFIQAPFATLEDLFRKLPEDIGFNIELKYPMLHESEEHEMDTYAVELNSFCDTV
LAKVYDLAGERHIIFSSFNPDVCLCLSFKQPSIPILFLTDAGCSSVGDIRASSLQEAVRFASRWNLLGIVSAAEP
LINSPRLVRVVKELGLVCVSYGVLNNDPTLVQRQVKEGIDAVIVDSVLAIRKGLTSNDTSTEQSTGTTPEAIENT
ENNKT*
Coding >Ophcf2|04947
ATGTCGGCCGCGATCGCGGATGTTTCTCGGAAAGGACGTCGTCTCGCGGAGCTCGACCAGCAGCTGGACGCTGCT
CGACAAGCCCTCGTCGCCTTGCAAAGCGCTGATACGACCTCAAAGGAACCCGAGGCGCCGTCTCTCGATGCAGCG
ATGCCCGAAATCTCTCTCGATCAGATGAAACATCTATGGGTCTCTCTCAAAGAGGTGTGGTTCGCTCGACCGTAC
ATGAAGGAGCTGCATATGCCCGCCACCGCCAGTACCTCGAAGCTCGTGCTGAGTCTCAAGGAGCGTCTCTATGGA
AGCCCTACGGAAGAAAGCATGCGGGATACACGAAAGACCGACTACAAGAGATATCATCGAGAAGCTCTGGCCGAG
GAATCTGATCCCTCCATCATTGTCCGCGAGGCACAGAAGGACTCGCATCTGCACCACGAGTCGCGAGCCGTGGAG
CACGTCGTCTTGCAGCTGCTTTCCCGCGCCGCCAAGATCCATACCTGTGCCCGGCGCGGACAGAATCCATCCTTC
GACGAGGCCAGGGACTTGGTTTCCCGCAGCGCGATGCAGTACACATATCCCATCATCGACCGCGAGCGATGGAGA
CGAAACCAGCTACTCTTGAACAAGTGCCTGCGGGAGGTCATTGATCTCCGTAACATACCGCTGAGGGAGAAGATT
GGCCGGATCTGCTATAATCTCCTCGTTTCTGCGTACGCGCCGGACATACATCACTACAACACGCTCATCGTCGCC
TTCGACGAGGCCGGTCTTCACGCCTTTGCCGAAGCAATCATCTGGTCCTTCTTTCATGGACGCCTGCTGCGGCCT
ACCGCACTCACCTACATTGCCATTCTCAACCACTGCAAAGTCGTCGGCAACCATGGGAGATTTCTCATGGCCCTT
GCTCGCATAGCAGGCTGCGACTCGGCCATCGGTGGAAAGATAGCACGGAGGCACATCGAGGACTGCGTCAGAGAC
GGACAACTCAACGAGTGGGCCTCTGACACCGACCTACGAACGCAGATCGGAGAGTGGGTGTACGAGCACGTCCCG
CTCAATCGAGCCATCGTAGCCGAGATCATCACCGGTTTGCTCCGATTTCACATGTTCCATCACGCCGTCCATTTC
TTCTTCGCATGCGTCCAATGCGAGGTCTTCTTGAGTGCGGCCGTGGTCAAGAACCTTCTCGACGAGTGCGTGGCT
GCTCTTGACTGGAAAGGCGCGTTCGAGTTGATCTACGGCCTCTTGGTCCACGACCGGTCTTGGAAGGCCTTTCTG
TTGACGGGAGACGTTGCCGCGGATTGGTACCTGATCAACCGGATATACACCTTGCTCGACATCTGCGGTCTGCGC
TACGGCCCGCAGTGGACGTCACGAGAATACCTGGACGCCCTGGGCATTCCGCCGGAGAGGCTCGCCGGCCTCTTG
TTCGACCTCGAGCTGCACGAGCAGTGGTTGCATCGGCCTTGCTTCCCGGAGAGCTTCAAGGGGAAGCCGGACATG
GCCGTTGGCGCAAAAAGCAAGCTCCTTCAGCTGGAGAGCATTTCTAAAGAGTACGTCTACGTGAGGAAGACGACC
AAGTCCATCGAAAGCAAGCTGTTGTATCCCGATTTCCCCCTCGAGTGGCGAGTTTCCATGGCTCATCACATCGGA
GGCGCGGCCCTTCAACAAGCCTCGCAGCTGATCAAGGACGTCGAGGACATGCTGAGAAGCATCGTTGGCTTCGGC
CCTTGGCTCTACCCAATCGATTCGGACCGCCGCATGGAAGCGAGGAAGAGGTATCTCAGGCGCGCTCGTGAGGAG
GCCAGTGATGAAGCGGAGACGGGGCTGGAGGGTGAAGCGACCGGGTCATCACGCACAGAAGCGCTACCAGCGCAG
GGCAACCTGGTTCCTATCCATACCTGCCCTCGAGAGGCTGCGGAACGGAAGCAGCGACAGGCTCTCGTCTCGCAA
CTTCGAGCACTCAGGCATGAAGTGGATCAGCCGCGTGTCGAGACGGTCTCGCTGCAAAGCCCCGAACGCTCGGCG
CTGGAAGAGGAAATGATATCGCAGATTCGGGCGCTGAGGCGTGGCGGGGAAGAGCCAACTCTCAAGGCACCAACA
TCGCCCCAAGAGGCTCATCAAGACTCTGCCAGCCTCGTGGAAGAAAGCGAGTCTCTGGCGCAGCCCGCTGGAACG
AAGCGGGAATCGACTGAGCAGCCACCCCAAGGCACGTCGCTCGCATTGGCTTTGAGGGAGCAGCATGGGGTCATG
GTGCCCCTGCCCGAGGGTTCACGTTTTCTTGACATTATTCGGAGTCGGTACAGACGATCTGATACGTCAGACGAG
GGCGTGCTTCGACATGTCCAGAAGCGGCGGGATCCAGCTGCGCCGAATGTGCGCCGTACGGAGGCTACGCAGAAA
TCTCGGTGCGATAGGTCGAATCGCGATAGGTCGAATCTCGGCCGGATCATGCAAGACGCTCGAATATCCGATGCC
CGAACACCTTTGAGGAGCAGAGAGAACGAGGTGAAAAGACGGCGGCCCGTGGCGAGATGGAACGAGGCAGCACAG
CCGCCCTCGCGAGACGCGCATCTTGCAAGAAGAGAAAGGCAGGAGACGCGGCGGCAGACGTGGAAACCTGGTGCA
ACTATGCCGGTCTCGCAAGGAGGCACGGAGATGAACACGAAACAGCTCATTGCTCTCTGGAGTCCAACAGCCTAT
GCATCGAGCACGATGGAGAGTCGAGAGGACCTTGATGCAGCCGCAGCTGGCAAGAATTCTCGAACGACGCCTAAG
CCACGAATGCGAAATAAAGTCCGAAGAGGCATGCAACTCCTTCGAAAGGCTGGAAGGGAGCTGACAATGGAACTG
CCACTGGAGGCCTTTGCGCCACATTTGGTCGAGCCGACAGTGGAAGACGATCCTCATGAGGCGGCCCGTGTTGCA
GCAGATGCAAAGGACTACAAAGACTGCGCAAAAGTGAGGATTGGAAAGAAGTCGGAAAAGGCCAAATCGTCAGAC
GGAGGCAGGCGTCCCGCAACGGCCGATATCGCCGCAGAGACCCAAGGGCAAGATTCGCCATGGTCGCCGATGAAG
CGCCAAGCGGCCAAGCCGTCAGACAGAATGGCCCATGTCTCGGAAGACTCCGGTGACGTGTGGACTACAATGGGG
TCGGCTTCGAAGACAAAGTTGTCAGACAGAGACAAGTCGGGCGCACAAAACGCGCGGGCGGAACTCGAAACTCCC
CAAACGCCCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCGTCGCCGGCATGAAATTCGGACGCAGC
CTCCCGCGCAACCAGGTGCCCCAGTGGGCGGCCTTCTACATCAATTACAAGGGCCTCAAGAAACTGGTCAAGGCG
GCGTCTCAGAGAGCCCAGGATGGCGTCGCCGTTGATCCCGCAGAGCTCTTCTTCGCCCTCGACCGCAACCTCGAG
GACGTCGACTCCTTCTACAACAAGAAGTTTGCAGAGGCGTGTCGGCGGCTCAACATCCTCCACAACCGCTACGGC
CGCGTCCCGGACGTGGTCGCCACCCTCGATCAGGATGAGGTCGAGGAGGTCATGGCCGCCCTTCTCGAGCTGAGG
ACCCAACTGAGGAACCTCCAGTGGTTCGGCGAGATTAACCGTAGGGGCTTCGTCAAGATCACCAAGAAGCTCGAT
AAAAAGGTTCCCGCAATGTCGTCTCAGCACCGCTATATATCCACAAAGGTCGATCCCAAGCCGTTTGCCAAGGAC
GGCAGCATCGCTCGCCTGCTGGCCGAGATCAACCGCTGGCTATCCGTCCTCGGTGATGCCGACAACGTCGACGAT
TCCACCTCGGACCGATCCACCCGCTCCCTGGGCCGCGCCTCGGCCAAGGCCATGCTACTACTGCCTCAGGCCCAG
CTCGACGCCCTGGACCAGGCAGTCCGAAACGATGACGTCGTCGCTCTCAAGTCGGGCGTCGACGAGGCCAGCCTC
CTGGGCGGTCTTGACGCTCAAGGCCAGAGTCAGGGACAGGGCCTCTTGCTCAACCTGCTCCAGCGGTCCATCTCG
GCCCGCTCGAGGGACTGCATGGCCCACCTCCTGGCCTGTATCAAGGACCTGGACGAGCCCGACGACATCAACGGC
CGCAACTGCATCCATCGATTCGTCATACACATCGGACGCACCAAGTCGGCAGCGCTGCCCACGAACGGCGGCGGC
GACAGCGCCAAGCCCTATCCCCAGTTCATCCAGGGCCACATCCAGCCGGCCGTCTCGTCAACGGTCCCCGTCAAG
ACGATCAACACCAAGGAGGAGGACCACCTCGGCGAGGACGACGAGGCCGTCCAGACGCTCCTCTTCCTCCTCGGA
CAGCTGACGGCGCAGCAGCGGCAGGCCCTCAACAGGCGCGACTCGCTGGGTCGTCTACCGTTGCACTACGCGGCG
CAGTTCGGCTTCGTGGTGGTGTGCCAGATCATCATGGGCAAGATGCAGGAGTGGAACCAGTTCGACGTCAAGGAC
GGCATCGACGCGCCCGAGTGGCAGGACAACGACGGCTACGCGCCGCTGCACCTCAGCGTCATCGGGGGCCATCCG
CTCACGACGCAGGCACTGCTGCAGGGCGAGAACTGGCAGGGCAGCAGCGAGGCCAAGGAGGAGCTGCGCAAGTCG
GTGCCCAAGTCGGGCGCGGTGCTGGCACTGGCGGTCAAGTCCAACTACGAGCCCATTGTCGAGATGCTGGTCAAG
GCGGGCGTCGACATCAACTGGACGGACAAGACGGGCGAGTCGGTGCTGCACATTGCCGCCAGGCACGGCCACGTC
GGCTGTGCGCGCATCATCCTCGAGGGCAGCGGCTCGCAGAGGGCGGAGCTGGAGACGACGGAGAAGGCCTACTCT
TGGACGCCGTTGCACGTGGCGGCCGTCGACGGATCCGTGGCCGTGGCCCGGCTGCTGATGGAGGCCGGCGCCGAC
GTCTCGAGGCCGGACGCCTCGGGCTGGACGGCCAAGGAGCACGCGGCCCTGCGTGGCCACATGGACATGGCCCGG
ATGCTGGCCGTTCACACCAACGAGGACGAGGCCGTATCGCGGGTGGCGGCTCGGCTGCAGGCGCCCGAGAACTCT
TCCATCGATGAGCGGCGATCCATTGGCGGTCCGAGGCCGGCCGAGCCGGTCAAGAGTTTCGGACATCGTTATCTG
ACAAACGAGAGCCTGGTGCTCGTCAGCCTCGGCTCTATGGATATCCGAAAGAGCACCGATGTCGTCAACCTGGAG
TGCGTGCCCCTGACCGAGGCTCACAACACGCAGCTCGATACCGCCTTGTCGGTCGTCGTCAGCGCCAACGGGGCT
CAGGGGGAGCCTACCATCATCGACCTGCCGGTACACGAGGGCATCTCAACCGAGCCCGTCGTCTTCACGACGCGA
GACGCTACCAAGGTCAAGCTCCTGTTCGACATGGTCCCGACCTACTCGGGCAGCGAGAAGAACAAGATCGGCAGG
GCGGTGGCGCTGCTTTCGTCGATCAAGCCGACGCTGGGCACGCAGCGCGTCAACCTACAGGGCGACGTGTGCGTG
CCCATCATGTCGAGCAACCTCGACGTCATGGGCACCGTCAACTTCAACTTCCTCGTCATCACGCCCTTTCACCAC
GTCAACATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTATCGTCAACCATGGTCATCGGTCATCGGGGA
CTGGGCAAGAACCTCACGTCCAACAAGTCGCTGCAGCTGGGCGAAAACACGCTGCCGTCCTTCATCGCGGCCGCC
AATCTCGGGGCGCAGTATGTCGAGTTCGACGTACAGCTCACAAAGGATCATGTGCCCGTCATTTACCACGACTTC
CTCGTCAGCGAGACGGGAATCGACGCGCCCGTTCACACCCTCACTCTCGAGCAGTTCCTCCACATCAACTCGGAC
AAGAGGCGGGCCGACGGCGGCGCTCCGCTCCCGGGTGGGGGCTCGGGCCGGGACGTGCCCCGGGAGCGGTCGCCG
CGACCCCGGAGTAACAGCCTGGCGCCGCAGCGGTCTCTGTCGATGGGATACGCCGGTGTCGGTCACGAGGAGATG
GAGGAGCGGATGCGGCACACGCGCGACTTCAAGGAGAAGGGCTACAAGGCCAACTCGCGCGGCAACTTCATCCAG
GCGCCCTTCGCCACGCTCGAGGACCTGTTCCGGAAGCTGCCCGAGGATATCGGCTTCAACATCGAGCTCAAGTAT
CCGATGCTGCACGAGAGCGAGGAGCACGAGATGGACACGTACGCCGTCGAGCTCAACTCGTTCTGCGACACGGTC
CTGGCCAAGGTGTACGATCTGGCCGGCGAGCGGCACATCATCTTCAGCTCCTTCAACCCGGACGTGTGTCTGTGT
CTGAGCTTCAAGCAGCCGTCGATCCCGATCCTGTTCTTGACCGATGCCGGCTGCAGTTCTGTCGGCGACATCCGG
GCTTCGTCGCTGCAGGAGGCGGTCCGGTTCGCGAGCCGCTGGAACCTGCTGGGCATCGTGTCTGCGGCCGAGCCG
CTCATCAACAGCCCGAGGCTGGTGCGTGTCGTCAAGGAGCTGGGACTGGTGTGCGTCAGCTACGGCGTGCTGAAC
AATGACCCGACGCTGGTTCAGCGACAAGTCAAGGAGGGCATAGACGCCGTCATCGTCGACAGCGTCTTGGCCATT
CGGAAGGGTCTGACGAGCAACGATACCAGCACGGAGCAGTCGACAGGAACGACGCCCGAGGCCATTGAGAACACG
GAGAACAACAAGACATAG
Transcript >Ophcf2|04947
ATGTCGGCCGCGATCGCGGATGTTTCTCGGAAAGGACGTCGTCTCGCGGAGCTCGACCAGCAGCTGGACGCTGCT
CGACAAGCCCTCGTCGCCTTGCAAAGCGCTGATACGACCTCAAAGGAACCCGAGGCGCCGTCTCTCGATGCAGCG
ATGCCCGAAATCTCTCTCGATCAGATGAAACATCTATGGGTCTCTCTCAAAGAGGTGTGGTTCGCTCGACCGTAC
ATGAAGGAGCTGCATATGCCCGCCACCGCCAGTACCTCGAAGCTCGTGCTGAGTCTCAAGGAGCGTCTCTATGGA
AGCCCTACGGAAGAAAGCATGCGGGATACACGAAAGACCGACTACAAGAGATATCATCGAGAAGCTCTGGCCGAG
GAATCTGATCCCTCCATCATTGTCCGCGAGGCACAGAAGGACTCGCATCTGCACCACGAGTCGCGAGCCGTGGAG
CACGTCGTCTTGCAGCTGCTTTCCCGCGCCGCCAAGATCCATACCTGTGCCCGGCGCGGACAGAATCCATCCTTC
GACGAGGCCAGGGACTTGGTTTCCCGCAGCGCGATGCAGTACACATATCCCATCATCGACCGCGAGCGATGGAGA
CGAAACCAGCTACTCTTGAACAAGTGCCTGCGGGAGGTCATTGATCTCCGTAACATACCGCTGAGGGAGAAGATT
GGCCGGATCTGCTATAATCTCCTCGTTTCTGCGTACGCGCCGGACATACATCACTACAACACGCTCATCGTCGCC
TTCGACGAGGCCGGTCTTCACGCCTTTGCCGAAGCAATCATCTGGTCCTTCTTTCATGGACGCCTGCTGCGGCCT
ACCGCACTCACCTACATTGCCATTCTCAACCACTGCAAAGTCGTCGGCAACCATGGGAGATTTCTCATGGCCCTT
GCTCGCATAGCAGGCTGCGACTCGGCCATCGGTGGAAAGATAGCACGGAGGCACATCGAGGACTGCGTCAGAGAC
GGACAACTCAACGAGTGGGCCTCTGACACCGACCTACGAACGCAGATCGGAGAGTGGGTGTACGAGCACGTCCCG
CTCAATCGAGCCATCGTAGCCGAGATCATCACCGGTTTGCTCCGATTTCACATGTTCCATCACGCCGTCCATTTC
TTCTTCGCATGCGTCCAATGCGAGGTCTTCTTGAGTGCGGCCGTGGTCAAGAACCTTCTCGACGAGTGCGTGGCT
GCTCTTGACTGGAAAGGCGCGTTCGAGTTGATCTACGGCCTCTTGGTCCACGACCGGTCTTGGAAGGCCTTTCTG
TTGACGGGAGACGTTGCCGCGGATTGGTACCTGATCAACCGGATATACACCTTGCTCGACATCTGCGGTCTGCGC
TACGGCCCGCAGTGGACGTCACGAGAATACCTGGACGCCCTGGGCATTCCGCCGGAGAGGCTCGCCGGCCTCTTG
TTCGACCTCGAGCTGCACGAGCAGTGGTTGCATCGGCCTTGCTTCCCGGAGAGCTTCAAGGGGAAGCCGGACATG
GCCGTTGGCGCAAAAAGCAAGCTCCTTCAGCTGGAGAGCATTTCTAAAGAGTACGTCTACGTGAGGAAGACGACC
AAGTCCATCGAAAGCAAGCTGTTGTATCCCGATTTCCCCCTCGAGTGGCGAGTTTCCATGGCTCATCACATCGGA
GGCGCGGCCCTTCAACAAGCCTCGCAGCTGATCAAGGACGTCGAGGACATGCTGAGAAGCATCGTTGGCTTCGGC
CCTTGGCTCTACCCAATCGATTCGGACCGCCGCATGGAAGCGAGGAAGAGGTATCTCAGGCGCGCTCGTGAGGAG
GCCAGTGATGAAGCGGAGACGGGGCTGGAGGGTGAAGCGACCGGGTCATCACGCACAGAAGCGCTACCAGCGCAG
GGCAACCTGGTTCCTATCCATACCTGCCCTCGAGAGGCTGCGGAACGGAAGCAGCGACAGGCTCTCGTCTCGCAA
CTTCGAGCACTCAGGCATGAAGTGGATCAGCCGCGTGTCGAGACGGTCTCGCTGCAAAGCCCCGAACGCTCGGCG
CTGGAAGAGGAAATGATATCGCAGATTCGGGCGCTGAGGCGTGGCGGGGAAGAGCCAACTCTCAAGGCACCAACA
TCGCCCCAAGAGGCTCATCAAGACTCTGCCAGCCTCGTGGAAGAAAGCGAGTCTCTGGCGCAGCCCGCTGGAACG
AAGCGGGAATCGACTGAGCAGCCACCCCAAGGCACGTCGCTCGCATTGGCTTTGAGGGAGCAGCATGGGGTCATG
GTGCCCCTGCCCGAGGGTTCACGTTTTCTTGACATTATTCGGAGTCGGTACAGACGATCTGATACGTCAGACGAG
GGCGTGCTTCGACATGTCCAGAAGCGGCGGGATCCAGCTGCGCCGAATGTGCGCCGTACGGAGGCTACGCAGAAA
TCTCGGTGCGATAGGTCGAATCGCGATAGGTCGAATCTCGGCCGGATCATGCAAGACGCTCGAATATCCGATGCC
CGAACACCTTTGAGGAGCAGAGAGAACGAGGTGAAAAGACGGCGGCCCGTGGCGAGATGGAACGAGGCAGCACAG
CCGCCCTCGCGAGACGCGCATCTTGCAAGAAGAGAAAGGCAGGAGACGCGGCGGCAGACGTGGAAACCTGGTGCA
ACTATGCCGGTCTCGCAAGGAGGCACGGAGATGAACACGAAACAGCTCATTGCTCTCTGGAGTCCAACAGCCTAT
GCATCGAGCACGATGGAGAGTCGAGAGGACCTTGATGCAGCCGCAGCTGGCAAGAATTCTCGAACGACGCCTAAG
CCACGAATGCGAAATAAAGTCCGAAGAGGCATGCAACTCCTTCGAAAGGCTGGAAGGGAGCTGACAATGGAACTG
CCACTGGAGGCCTTTGCGCCACATTTGGTCGAGCCGACAGTGGAAGACGATCCTCATGAGGCGGCCCGTGTTGCA
GCAGATGCAAAGGACTACAAAGACTGCGCAAAAGTGAGGATTGGAAAGAAGTCGGAAAAGGCCAAATCGTCAGAC
GGAGGCAGGCGTCCCGCAACGGCCGATATCGCCGCAGAGACCCAAGGGCAAGATTCGCCATGGTCGCCGATGAAG
CGCCAAGCGGCCAAGCCGTCAGACAGAATGGCCCATGTCTCGGAAGACTCCGGTGACGTGTGGACTACAATGGGG
TCGGCTTCGAAGACAAAGTTGTCAGACAGAGACAAGTCGGGCGCACAAAACGCGCGGGCGGAACTCGAAACTCCC
CAAACGCCCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCGTCTTCGTCGTCGCCGGCATGAAATTCGGACGCAGC
CTCCCGCGCAACCAGGTGCCCCAGTGGGCGGCCTTCTACATCAATTACAAGGGCCTCAAGAAACTGGTCAAGGCG
GCGTCTCAGAGAGCCCAGGATGGCGTCGCCGTTGATCCCGCAGAGCTCTTCTTCGCCCTCGACCGCAACCTCGAG
GACGTCGACTCCTTCTACAACAAGAAGTTTGCAGAGGCGTGTCGGCGGCTCAACATCCTCCACAACCGCTACGGC
CGCGTCCCGGACGTGGTCGCCACCCTCGATCAGGATGAGGTCGAGGAGGTCATGGCCGCCCTTCTCGAGCTGAGG
ACCCAACTGAGGAACCTCCAGTGGTTCGGCGAGATTAACCGTAGGGGCTTCGTCAAGATCACCAAGAAGCTCGAT
AAAAAGGTTCCCGCAATGTCGTCTCAGCACCGCTATATATCCACAAAGGTCGATCCCAAGCCGTTTGCCAAGGAC
GGCAGCATCGCTCGCCTGCTGGCCGAGATCAACCGCTGGCTATCCGTCCTCGGTGATGCCGACAACGTCGACGAT
TCCACCTCGGACCGATCCACCCGCTCCCTGGGCCGCGCCTCGGCCAAGGCCATGCTACTACTGCCTCAGGCCCAG
CTCGACGCCCTGGACCAGGCAGTCCGAAACGATGACGTCGTCGCTCTCAAGTCGGGCGTCGACGAGGCCAGCCTC
CTGGGCGGTCTTGACGCTCAAGGCCAGAGTCAGGGACAGGGCCTCTTGCTCAACCTGCTCCAGCGGTCCATCTCG
GCCCGCTCGAGGGACTGCATGGCCCACCTCCTGGCCTGTATCAAGGACCTGGACGAGCCCGACGACATCAACGGC
CGCAACTGCATCCATCGATTCGTCATACACATCGGACGCACCAAGTCGGCAGCGCTGCCCACGAACGGCGGCGGC
GACAGCGCCAAGCCCTATCCCCAGTTCATCCAGGGCCACATCCAGCCGGCCGTCTCGTCAACGGTCCCCGTCAAG
ACGATCAACACCAAGGAGGAGGACCACCTCGGCGAGGACGACGAGGCCGTCCAGACGCTCCTCTTCCTCCTCGGA
CAGCTGACGGCGCAGCAGCGGCAGGCCCTCAACAGGCGCGACTCGCTGGGTCGTCTACCGTTGCACTACGCGGCG
CAGTTCGGCTTCGTGGTGGTGTGCCAGATCATCATGGGCAAGATGCAGGAGTGGAACCAGTTCGACGTCAAGGAC
GGCATCGACGCGCCCGAGTGGCAGGACAACGACGGCTACGCGCCGCTGCACCTCAGCGTCATCGGGGGCCATCCG
CTCACGACGCAGGCACTGCTGCAGGGCGAGAACTGGCAGGGCAGCAGCGAGGCCAAGGAGGAGCTGCGCAAGTCG
GTGCCCAAGTCGGGCGCGGTGCTGGCACTGGCGGTCAAGTCCAACTACGAGCCCATTGTCGAGATGCTGGTCAAG
GCGGGCGTCGACATCAACTGGACGGACAAGACGGGCGAGTCGGTGCTGCACATTGCCGCCAGGCACGGCCACGTC
GGCTGTGCGCGCATCATCCTCGAGGGCAGCGGCTCGCAGAGGGCGGAGCTGGAGACGACGGAGAAGGCCTACTCT
TGGACGCCGTTGCACGTGGCGGCCGTCGACGGATCCGTGGCCGTGGCCCGGCTGCTGATGGAGGCCGGCGCCGAC
GTCTCGAGGCCGGACGCCTCGGGCTGGACGGCCAAGGAGCACGCGGCCCTGCGTGGCCACATGGACATGGCCCGG
ATGCTGGCCGTTCACACCAACGAGGACGAGGCCGTATCGCGGGTGGCGGCTCGGCTGCAGGCGCCCGAGAACTCT
TCCATCGATGAGCGGCGATCCATTGGCGGTCCGAGGCCGGCCGAGCCGGTCAAGAGTTTCGGACATCGTTATCTG
ACAAACGAGAGCCTGGTGCTCGTCAGCCTCGGCTCTATGGATATCCGAAAGAGCACCGATGTCGTCAACCTGGAG
TGCGTGCCCCTGACCGAGGCTCACAACACGCAGCTCGATACCGCCTTGTCGGTCGTCGTCAGCGCCAACGGGGCT
CAGGGGGAGCCTACCATCATCGACCTGCCGGTACACGAGGGCATCTCAACCGAGCCCGTCGTCTTCACGACGCGA
GACGCTACCAAGGTCAAGCTCCTGTTCGACATGGTCCCGACCTACTCGGGCAGCGAGAAGAACAAGATCGGCAGG
GCGGTGGCGCTGCTTTCGTCGATCAAGCCGACGCTGGGCACGCAGCGCGTCAACCTACAGGGCGACGTGTGCGTG
CCCATCATGTCGAGCAACCTCGACGTCATGGGCACCGTCAACTTCAACTTCCTCGTCATCACGCCCTTTCACCAC
GTCAACATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGCTATCGTCAACCATGGTCATCGGTCATCGGGGA
CTGGGCAAGAACCTCACGTCCAACAAGTCGCTGCAGCTGGGCGAAAACACGCTGCCGTCCTTCATCGCGGCCGCC
AATCTCGGGGCGCAGTATGTCGAGTTCGACGTACAGCTCACAAAGGATCATGTGCCCGTCATTTACCACGACTTC
CTCGTCAGCGAGACGGGAATCGACGCGCCCGTTCACACCCTCACTCTCGAGCAGTTCCTCCACATCAACTCGGAC
AAGAGGCGGGCCGACGGCGGCGCTCCGCTCCCGGGTGGGGGCTCGGGCCGGGACGTGCCCCGGGAGCGGTCGCCG
CGACCCCGGAGTAACAGCCTGGCGCCGCAGCGGTCTCTGTCGATGGGATACGCCGGTGTCGGTCACGAGGAGATG
GAGGAGCGGATGCGGCACACGCGCGACTTCAAGGAGAAGGGCTACAAGGCCAACTCGCGCGGCAACTTCATCCAG
GCGCCCTTCGCCACGCTCGAGGACCTGTTCCGGAAGCTGCCCGAGGATATCGGCTTCAACATCGAGCTCAAGTAT
CCGATGCTGCACGAGAGCGAGGAGCACGAGATGGACACGTACGCCGTCGAGCTCAACTCGTTCTGCGACACGGTC
CTGGCCAAGGTGTACGATCTGGCCGGCGAGCGGCACATCATCTTCAGCTCCTTCAACCCGGACGTGTGTCTGTGT
CTGAGCTTCAAGCAGCCGTCGATCCCGATCCTGTTCTTGACCGATGCCGGCTGCAGTTCTGTCGGCGACATCCGG
GCTTCGTCGCTGCAGGAGGCGGTCCGGTTCGCGAGCCGCTGGAACCTGCTGGGCATCGTGTCTGCGGCCGAGCCG
CTCATCAACAGCCCGAGGCTGGTGCGTGTCGTCAAGGAGCTGGGACTGGTGTGCGTCAGCTACGGCGTGCTGAAC
AATGACCCGACGCTGGTTCAGCGACAAGTCAAGGAGGGCATAGACGCCGTCATCGTCGACAGCGTCTTGGCCATT
CGGAAGGGTCTGACGAGCAACGATACCAGCACGGAGCAGTCGACAGGAACGACGCCCGAGGCCATTGAGAACACG
GAGAACAACAAGACATAG
Gene >Ophcf2|04947
ATGTCGGCCGCGATCGCGGATGTTTCTCGGAAAGGACGTCGTCTCGCGGAGCTCGACCAGCAGCTGGACGCTGCT
CGACAAGCCCTCGTCGCCTTGCAAAGCGCTGATACGACCTCAAAGGAACCCGAGGCGCCGTCTCTCGATGCAGCG
ATGCCCGAAATCTCTCTCGATCAGATGAAACATCTATGGGTCTCTCTCAAAGAGGTGTGGTTCGCTCGACCGTAC
ATGAAGGAGCTGCATATGCCCGCCACCGCCAGTACCTCGAAGCTCGTGCTGAGTCTCAAGGAGCGTCTCTATGGA
AGCCCTACGGAAGAAAGCATGCGGGATACACGAAAGACCGACTACAAGAGATATCATCGAGAAGCTCTGGCCGAG
GAATCTGATCCCTCCATCATTGTCCGCGAGGCACAGAAGGACTCGCATCTGCACCACGAGTCGCGAGCCGTGGAG
CACGTCGTCTTGCAGCTGCTTTCCCGCGCCGCCAAGATCCATACCTGTGCCCGGCGCGGACAGAATCCATCCTTC
GACGAGGCCAGGGACTTGGTTTCCCGCAGCGCGATGCAGTACACATATCCCATCATCGACCGCGAGCGATGGAGA
CGAAACCAGCTACTCTTGAACAAGTGCCTGCGGGAGGTCATTGATCTCCGTAACATACCGCTGAGGGAGAAGATT
GGCCGGATCTGCTATAATCTCCTCGTTTCTGCGTACGCGCCGGACATACATCACTACAACACGCTCATCGTCGCC
TTCGACGAGGCCGGTCTTCACGCCTTTGCCGAAGCAATCATCTGGTCCTTCTTTCATGGACGCCTGCTGCGGCCT
ACCGCACTCACCTACATTGCCATTCTCAACCACTGCAAAGTCGTCGGCAACCATGGGAGATTTCTCATGGCCCTT
GCTCGCATAGCAGGCTGCGACTCGGCCATCGGTGGAAAGATAGCACGGAGGCACATCGAGGACTGCGTCAGAGAC
GGACAACTCAACGAGTGGGCCTCTGACACCGACCTACGAACGCAGATCGGAGAGTGGGTGTACGAGCACGTCCCG
CTCAATCGAGCCATCGTAGCCGAGATCATCACCGGTTTGCTCCGATTTCACATGTTCCATCACGCCGTCCATTTC
TTCTTCGCATGCGTCCAATGCGAGGTCTTCTTGAGTGCGGCCGTGGTCAAGAACCTTCTCGACGAGTGCGTGGCT
GCTCTTGACTGGAAAGGCGCGTTCGAGTTGATCTACGGCCTCTTGGTCCACGACCGGTCTTGGAAGGCCTTTCTG
TTGACGGGAGACGTTGCCGCGGATTGGTACCTGATCAACCGGATATACACCTTGCTCGACATCTGCGGTCTGCGC
TACGGCCCGCAGTGGACGTCACGAGAATACCTGGACGCCCTGGGCATTCCGCCGGAGAGGCTCGCCGGCCTCTTG
TTCGACCTCGAGCTGCACGAGCAGTGGTTGCATCGGCCTTGCTTCCCGGAGAGCTTCAAGGGGAAGCCGGACATG
GCCGTTGGCGCAAAAAGCAAGCTCCTTCAGCTGGAGAGCATTTCTAAAGAGTACGTCTACGTGAGGAAGACGACC
AAGTCCATCGAAAGCAAGCTGTTGTATCCCGATTTCCCCCTCGAGTGGCGAGTTTCCATGGCTCATCACATCGGA
GGCGCGGCCCTTCAACAAGCCTCGCAGCTGATCAAGGACGTCGAGGACATGCTGAGAAGCATCGTTGGCTTCGGC
CCTTGGCTCTACCCAATCGATTCGGACCGCCGCATGGAAGCGAGGAAGAGGTATCTCAGGCGCGCTCGTGAGGAG
GCCAGTGATGAAGCGGAGACGGGGCTGGAGGGTGAAGCGACCGGGTCATCACGCACAGAAGCGCTACCAGCGCAG
GGCAACCTGGTTCCTATCCATACCTGCCCTCGAGAGGCTGCGGAACGGAAGCAGCGACAGGCTCTCGTCTCGCAA
CTTCGAGCACTCAGGCATGAAGTGGATCAGCCGCGTGTCGAGACGGTCTCGCTGCAAAGCCCCGAACGCTCGGCG
CTGGAAGAGGAAATGATATCGCAGATTCGGGCGCTGAGGCGTGGCGGGGAAGAGCCAACTCTCAAGGCACCAACA
TCGCCCCAAGAGGCTCATCAAGACTCTGCCAGCCTCGTGGAAGAAAGCGAGTCTCTGGCGCAGCCCGCTGGAACG
AAGCGGGAATCGACTGAGCAGCCACCCCAAGGCACGTCGCTCGCATTGGCTTTGAGGGAGCAGCATGGGGTCATG
GTGCCCCTGCCCGAGGGTTCACGTTTTCTTGACATTATTCGGAGTCGGTACAGACGATCTGATACGTCAGACGAG
GGCGTGCTTCGACATGTCCAGAAGCGGCGGGATCCAGCTGCGCCGAATGTGCGCCGTACGGAGGCTACGCAGAAA
TCTCGGTGCGATAGGTCGAATCGCGATAGGTCGAATCTCGGCCGGATCATGCAAGACGCTCGAATATCCGATGCC
CGAACACCTTTGAGGAGCAGAGAGAACGAGGTGAAAAGACGGCGGCCCGTGGCGAGATGGAACGAGGCAGCACAG
CCGCCCTCGCGAGACGCGCATCTTGCAAGAAGAGAAAGGCAGGAGACGCGGCGGCAGACGTGGAAACCTGGTGCA
ACTATGCCGGTCTCGCAAGGAGGCACGGAGATGAACACGAAACAGCTCATTGCTCTCTGGAGTCCAACAGCCTAT
GCATCGAGCACGATGGAGAGTCGAGAGGACCTTGATGCAGCCGCAGCTGGCAAGAATTCTCGAACGACGCCTAAG
CCACGAATGCGAAATAAAGTCCGAAGAGGCATGCAACTCCTTCGAAAGGCTGGAAGGGAGCTGACAATGGAACTG
CCACTGGAGGCCTTTGCGCCACATTTGGTCGAGCCGACAGTGGAAGACGATCCTCATGAGGCGGCCCGTGTTGCA
GCAGATGCAAAGGACTACAAAGACTGCGCAAAAGTGAGGATTGGAAAGAAGTCGGAAAAGGCCAAATCGTCAGAC
GGAGGCAGGCGTCCCGCAACGGCCGATATCGCCGCAGAGACCCAAGGGCAAGATTCGCCATGGTCGCCGATGAAG
CGCCAAGCGGCCAAGCCGTCAGACAGAATGGCCCATGTCTCGGAAGACTCCGGTGACGTGTGGACTACAATGGGG
TCGGCTTCGAAGACAAAGTTGTCAGACAGAGACAAGTCGGGCGCACAAAACGGTGCACTGTCTCGGCAGTCATCA
AAGGCGCGGAAGAGGCATAACGACGGACGGCTTCCAGACAGGAAGAAGTCGCGTCGCCACTCGGTCGATGCAGGG
GCAGGCGCCGGAGCCGGGACGAAATAGCTGACAAAAGACATGAAGCACATGAAGCGCATGAAGCAGCGACTGCAG
CACGCAGGCTGGGCGGGCGGCCTGGGGGGGGAGGCCGGGGAGAGGCCGGGGAGAGGCAGCGGCCCAGTGAAATGA
CGGTGGCTGCAGCGTCGCTGATGCGAGCGGGAGCAGAGACGGTCACGCCAGCCAGCCCAATCAATGGTGGCTGGC
ACAGGCCCAGGCTGGCCCCCAGGCTGGGGCGGCGGATGTCGCGGTGGTGGCTGAGGGATGGACTGTCTGTGGTCG
ACTGGTCATGGGTCTCTGATGGAAGCTCTGATGGAAGCTCTGATGGAGTCAGTCGGACGGAGTCAAAATGGAAGA
GAAGGGCAGCCCGGCCCGGAAGCCGGAAATACATAAGAAGGATGCTGAGTCATCGGAGATGCTGTGACGTGACGT
GTATCGATCGTAAGTTCCAACGATGGAGGATGGTTTATAGTTATATTGGCATATCCATTCTGTTTGTTGTGGGCA
GCCTTGCCGTGTTGGGAGAGGCGGCAGTTTGAAAGCTCGAGACTTTGACAGGTGGGCTAGTGGTCGAAAGCACGA
CTCGAACACGGCGGGCTCGGACTCGTTTTCGCACGACCCCCGCTGGGTTTTCTCTTTAATGTTTTTTTATTTTGT
TCGGGACAACAACGACGACGACGACGACGATCCGTCCGTGGGATGACGTGGGAAACGAAAAGTTCTCAATTCTGC
TACGGTACCGCGTTTACGAACAATGCATTAAGCCAGTTAACCGCGCCGCACCGTGAGACGGCTGGTCGCTGGGCA
CTGTGATCCGAACAAAGGTTGGTTGTTGAAGCGCGGGCGGAACTCGAAACTCCCCAAACGCCCGTCGTCTTCGTC
GTCTTCGTCGTCTTCGTCGTCTTCGTCGTCGCCGGCATGAAATTCGGACGCAGGTGAGCCCTCTCTCTTCCAGCC
ATCTCGTTGTCAGGAGACTTGGGGGCTGAGTTTCCCCAAACGGCGTACAGCCTCCCGCGCAACCAGGTGCCCCAG
TGGGCGGCCTTCTACATCAATTACAAGGGCCTCAAGAAACTGGTCAAGGCGGCGTCTCAGAGAGCCCAGGATGGC
GTCGCCGTTGATCCCGCAGGTGGGCGCTACCACCAGCTGGCAGGCCGTCCCTTCACCCCCCTGACTCACCAGCAG
AGCTCTTCTTCGCCCTCGACCGCAACCTCGAGGACGTCGACTCCTTCTACAACAAGAAGTTTGCAGAGGCGTGTC
GGCGGCTCAACATCCTCCACAACCGCTACGGCCGCGTCCCGGACGTGGTCGCCACCCTCGATCAGGATGAGGTCG
AGGAGGTCATGGCCGCCCTTCTCGAGCTGAGGACCCAACTGAGGAACCTCCAGTGGTTCGGCGAGATTAACCGTA
GGGGCTTCGTCAAGATCACCAAGAAGCTCGATAAAAAGGTTCCCGCAATGTCGTCTCAGCACCGCTATATATCCA
CAAAGGTCGATCCCAAGCCGTTTGCCAAGGACGGCAGCATCGCTCGCCTGCTGGCCGAGATCAACCGCTGGCTAT
CCGTCCTCGGTGATGCCGACAACGTCGACGATTCCACCTCGGACCGATCCACCCGCTCCCTGGGCCGCGCCTCGG
CCAAGGCCATGCTACTACTGCCTCAGGCCCAGCTCGACGCCCTGGACCAGGCAGTCCGAAACGATGACGTCGTCG
CTCTCAAGTCGGGCGTCGACGAGGCCAGCCTCCTGGGCGGTCTTGACGCTCAAGGCCAGAGTCAGGGACAGGGCC
TCTTGCTCAACCTGCTCCAGCGGTCCATCTCGGCCCGCTCGAGGGACTGCATGGCCCACCTCCTGGCCTGTATCA
AGGACCTGGACGAGCCCGACGACATCAACGGCCGCAACTGCATCCATCGATTCGTCATACACATCGGACGCACCA
AGTCGGCAGCGCTGCCCACGAACGGCGGCGGCGACAGCGCCAAGCCCTATCCCCAGTTCATCCAGGGCCACATCC
AGCCGGCCGTCTCGTCAACGGTCCCCGTCAAGACGATCAACACCAAGGAGGAGGACCACCTCGGCGAGGACGACG
AGGCCGTCCAGACGCTCCTCTTCCTCCTCGGACAGCTGACGGCGCAGCAGCGGCAGGCCCTCAACAGGCGCGACT
CGCTGGGTCGTCTACCGTTGCACTACGCGGCGCAGTTCGGCTTCGTGGTGGTGTGCCAGATCATCATGGGCAAGA
TGCAGGAGTGGAACCAGTTCGACGTCAAGGACGGCATCGACGCGCCCGAGTGGCAGGACAACGACGGCTACGCGC
CGCTGCACCTCAGCGTCATCGGGGGCCATCCGCTCACGACGCAGGCACTGCTGCAGGGCGAGAACTGGCAGGGCA
GCAGCGAGGCCAAGGAGGAGCTGCGCAAGTCGGTGCCCAAGTCGGGCGCGGTGCTGGCACTGGCGGTCAAGTCCA
ACTACGAGCCCATTGTCGAGATGCTGGTCAAGGCGGGCGTCGACATCAACTGGACGGACAAGACGGGCGAGTCGG
TGCTGCACATTGCCGCCAGGCACGGCCACGTCGGCTGTGCGCGCATCATCCTCGAGGGCAGCGGCTCGCAGAGGG
CGGAGCTGGAGACGACGGAGAAGGCCTACTCTTGGACGCCGTTGCACGTGGCGGCCGTCGACGGATCCGTGGCCG
TGGCCCGGCTGCTGATGGAGGCCGGCGCCGACGTCTCGAGGCCGGACGCCTCGGGCTGGACGGCCAAGGAGCACG
CGGCCCTGCGTGGCCACATGGACATGGCCCGGATGCTGGCCGTTCACACCAACGAGGACGAGGCCGTATCGCGGG
TGGCGGCTCGGCTGCAGGCGCCCGAGAACTCTTCCATCGATGAGCGGCGATCCATTGGCGGTCCGAGGCCGGCCG
AGCCGGTCAAGAGTTTCGGACATCGTTATCTGACAAACGAGAGCCTGGTGCTCGTCAGCCTCGGCTCTATGGATA
TCCGAAAGAGCACCGATGTCGTCAACCTGGAGTGCGTGCCCCTGACCGAGGCTCACAACACGCAGCTCGATACCG
CCTTGTCGGTCGTCGTCAGCGCCAACGGGGCTCAGGGGGAGCCTACCATCATCGACCTGCCGGTACACGAGGGCA
TCTCAACCGAGCCCGTCGTCTTCACGACGCGAGACGCTACCAAGGTCAAGCTCCTGTTCGACATGGTCCCGACCT
ACTCGGGCAGCGAGAAGAACAAGATCGGCAGGGCGGTGGCGCTGCTTTCGTCGATCAAGCCGACGCTGGGCACGC
AGCGCGTCAACCTACAGGGCGACGTGTGCGTGCCCATCATGTCGAGCAACCTCGACGTCATGGGCACCGTCAACT
TCAACTTCCTCGTCATCACGCCCTTTCACCACGTCAACATGGAGGTGACGTCGCGGCAGACGTACTGGAAGAAGC
TATCGTCAACCATGGTCATCGGTCATCGGGGACTGGGCAAGAACCTCACGTCCAACAAGTCGCTGCAGCTGGGCG
AAAACACGCTGCCGTCCTTCATCGCGGCCGCCAATCTCGGGGCGCAGTATGTCGAGTTCGACGTACAGCTCACAA
AGGATCATGTGCCCGTCATTTACCACGACTTCCTCGTCAGCGAGACGGGAATCGACGCGCCCGTTCACACCCTCA
CTCTCGAGCAGTTCCTCCACATCAACTCGGACAAGAGGCGGGCCGACGGCGGCGCTCCGCTCCCGGGTGGGGGCT
CGGGCCGGGACGTGCCCCGGGAGCGGTCGCCGCGACCCCGGAGTAACAGCCTGGCGCCGCAGCGGTCTCTGTCGA
TGGGATACGCCGGTGTCGGTCACGAGGAGATGGAGGAGCGGATGCGGCACACGCGCGACTTCAAGGAGAAGGGCT
ACAAGGCCAACTCGCGCGGCAACTTCATCCAGGCGCCCTTCGCCACGCTCGAGGACCTGTTCCGGAAGCTGCCCG
AGGATATCGGCTTCAACATCGAGCTCAAGTATCCGATGCTGCACGAGAGCGAGGAGCACGAGATGGACACGTACG
CCGTCGAGCTCAACTCGTTCTGCGACACGGTCCTGGCCAAGGTGTACGATCTGGCCGGCGAGCGGCACATCATCT
TCAGCTCCTTCAACCCGGACGTGTGTCTGTGTCTGAGCTTCAAGCAGCCGTCGATCCCGATCCTGTTCTTGACCG
ATGCCGGCTGCAGTTCTGTCGGCGACATCCGGGCTTCGTCGCTGCAGGAGGCGGTCCGGTTCGCGAGCCGCTGGA
ACCTGCTGGGCATCGTGTCTGCGGCCGAGCCGCTCATCAACAGCCCGAGGCTGGTGCGTGTCGTCAAGGAGCTGG
GACTGGTGTGCGTCAGCTACGGCGTGCTGAACAATGACCCGACGCTGGTTCAGGTGGGTTTCCCCCATGTTCCCC
CTGGTGTATGTATCGTATGCACGAATCTGGCTGACGGAAGGGGGCTGGGGATAGCGACAAGTCAAGGAGGGCATA
GACGCCGTCATCGTCGACAGCGTCTTGGCCATTCGGAAGGGTCTGACGAGCAACGATACCAGCACGGAGCAGTCG
ACAGGAACGACGCCCGAGGCCATTGAGAACACGGAGAACAACAAGACATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail